KEGG   Laribacter hongkongensis: LHK_00790Help
Entry
LHK_00790         CDS       T00884                                 

Definition
Phospholipase A1 precursor (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lhk00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:lhk00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lhk00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:lhk00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757242..758375
Genome map
AA seq 377 aa AA seqDB search
MSTRYIWLAGVLLAGPAGAAGSGMAAGLEECTALADDGSRLACYDRLAGRAAGPGPVAAV
ADMSRAGSGPAPALAAPAATVAAGPATGDTAPVRVAETVFSPRQSVSMAERWELEPQYQD
GTFKFKPYAPVYLMPLNFRQRINNDPCSSNPVNCSHRGDQQYDKVGVKFQLSFKTKLWQD
MLGSDADLWAAYTQTSYWQAYDSANSSPFRETDYQPELWATLPVSWGPEAFRLRMVNFGL
MHQSNGQTNPLSRSWNRVFASFGFTSGDLSVIVKPWWRIPEPFPTDNNPDISDYMGRVEV
LASYPWRGHNFSLLLRNNLRFGASVPNRTFTQLEWAFPISGNLHGFVQAFNGWGESMQNY
NFHNRGIGVGISMVEWR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacacgttacatatggctggcgggcgtcctgctggcagggccggccggcgcggcc
ggctctggcatggctgcggggctggaggaatgcacggcgctggctgacgatggcagccgg
ctggcctgttacgaccggctggccggtcgtgcagccggacctggaccggttgctgcggta
gcggacatgtcccgggccggatcagggccggcgccggcgcttgccgccccggctgctact
gtggcagccggacccgctaccggggacaccgctcccgtacgtgtggccgaaacggtgttc
tccccccgtcagtccgtctccatggccgagcgctgggagctggagccgcaataccaggac
ggtacgttcaagttcaagccgtatgcaccggtgtacctgatgccgctgaacttccgccag
cgcatcaacaacgacccgtgctcgtccaatccggtcaactgttcgcaccggggcgaccag
caatatgacaaggtcggggtcaagttccagctgtcgttcaagaccaagctctggcaggac
atgctggggtcggacgccgacctgtgggccgcctatacccagaccagctactggcaggcg
tacgactcggccaattcttcgccgttccgcgaaaccgattaccagccggaactctgggcc
accctgccggtcagctgggggccggaagccttccggctgcgcatggtcaacttcggactg
atgcaccagtccaacggccagaccaatccgctgtcccgctcatggaaccgcgtgtttgcc
agcttcggcttcacctcgggcgacctgtcggtgatcgtcaagccgtggtggcggattccc
gaaccgttccccaccgacaacaatccggacatcagcgattacatgggccgggtcgaagtg
ctggcctcgtacccctggcgcggccacaatttttcattgctgttgcgcaacaacctgcgc
tttggcgcttcggtgcccaaccggactttcacccagctggaatgggcatttccgatcagc
ggcaatctgcatggtttcgtccaggcgttcaacggctggggtgagtcgatgcagaactac
aatttccacaaccgcggcatcggcgtcgggatttccatggtcgaatggcgctag

DBGET integrated database retrieval system