KEGG   Laribacter hongkongensis: LHK_00790Help
Entry
LHK_00790         CDS       T00884                                 

Definition
(GenBank) Phospholipase A1 precursor
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00564  Glycerophospholipid metabolism
lhk00565  Ether lipid metabolism
lhk00590  Arachidonic acid metabolism
lhk00592  alpha-Linolenic acid metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LHK_00790
   00565 Ether lipid metabolism
    LHK_00790
   00590 Arachidonic acid metabolism
    LHK_00790
   00591 Linoleic acid metabolism
    LHK_00790
   00592 alpha-Linolenic acid metabolism
    LHK_00790
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     LHK_00790
    3.1.1.32  phospholipase A1
     LHK_00790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: ACO73783
UniProt: C1D4I9
Position
757242..758375
Genome map
AA seq 377 aa AA seqDB search
MSTRYIWLAGVLLAGPAGAAGSGMAAGLEECTALADDGSRLACYDRLAGRAAGPGPVAAV
ADMSRAGSGPAPALAAPAATVAAGPATGDTAPVRVAETVFSPRQSVSMAERWELEPQYQD
GTFKFKPYAPVYLMPLNFRQRINNDPCSSNPVNCSHRGDQQYDKVGVKFQLSFKTKLWQD
MLGSDADLWAAYTQTSYWQAYDSANSSPFRETDYQPELWATLPVSWGPEAFRLRMVNFGL
MHQSNGQTNPLSRSWNRVFASFGFTSGDLSVIVKPWWRIPEPFPTDNNPDISDYMGRVEV
LASYPWRGHNFSLLLRNNLRFGASVPNRTFTQLEWAFPISGNLHGFVQAFNGWGESMQNY
NFHNRGIGVGISMVEWR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacacgttacatatggctggcgggcgtcctgctggcagggccggccggcgcggcc
ggctctggcatggctgcggggctggaggaatgcacggcgctggctgacgatggcagccgg
ctggcctgttacgaccggctggccggtcgtgcagccggacctggaccggttgctgcggta
gcggacatgtcccgggccggatcagggccggcgccggcgcttgccgccccggctgctact
gtggcagccggacccgctaccggggacaccgctcccgtacgtgtggccgaaacggtgttc
tccccccgtcagtccgtctccatggccgagcgctgggagctggagccgcaataccaggac
ggtacgttcaagttcaagccgtatgcaccggtgtacctgatgccgctgaacttccgccag
cgcatcaacaacgacccgtgctcgtccaatccggtcaactgttcgcaccggggcgaccag
caatatgacaaggtcggggtcaagttccagctgtcgttcaagaccaagctctggcaggac
atgctggggtcggacgccgacctgtgggccgcctatacccagaccagctactggcaggcg
tacgactcggccaattcttcgccgttccgcgaaaccgattaccagccggaactctgggcc
accctgccggtcagctgggggccggaagccttccggctgcgcatggtcaacttcggactg
atgcaccagtccaacggccagaccaatccgctgtcccgctcatggaaccgcgtgtttgcc
agcttcggcttcacctcgggcgacctgtcggtgatcgtcaagccgtggtggcggattccc
gaaccgttccccaccgacaacaatccggacatcagcgattacatgggccgggtcgaagtg
ctggcctcgtacccctggcgcggccacaatttttcattgctgttgcgcaacaacctgcgc
tttggcgcttcggtgcccaaccggactttcacccagctggaatgggcatttccgatcagc
ggcaatctgcatggtttcgtccaggcgttcaacggctggggtgagtcgatgcagaactac
aatttccacaaccgcggcatcggcgtcgggatttccatggtcgaatggcgctag

DBGET integrated database retrieval system