KEGG   Laribacter hongkongensis: LHK_00965Help
Entry
LHK_00965         CDS       T00884                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lhk  Laribacter hongkongensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lhk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927473..928084
Genome map
AA seq 203 aa AA seqDB search
MKTPASLESLITALRVLPGVGPKTAQRMAYHLMQRDPGGADRLARAIDHARSHLKHCARC
NTFSETELCVLCADDQRRQDVLCVVEMPADALMIEQTHSYDGLYFVLMGKVSPLDGLTAR
DIPLEQLARRALDGTVNEVILATNFTAEGEATAHVLATLFKDRGLSVSRIARGLPVGGEL
EHVDAGTLAQALYERRRLSTGDA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcccgcttccctcgagtcgctgatcacggcactgcgcgtgctgcccggcgtc
ggcccgaaaacggcccagcgcatggcctatcacctgatgcagcgtgatccgggcggtgcc
gaccggctggcccgggccatcgaccatgcccgttcccacctcaagcactgcgcccgctgc
aataccttcagcgaaaccgaactgtgcgtcctgtgcgccgacgaccagcgccggcaggac
gtgctgtgcgtggtcgaaatgccggccgatgcgctgatgatcgagcagacgcacagctac
gacgggctctacttcgtgctgatgggcaaggtgtcgccgcttgacggcctgaccgcccgc
gacatcccgctggaacagctggcacgccgggcgctggacggcacggtgaacgaagtgatc
ctggcgaccaacttcactgccgaaggcgaggccaccgcacacgtgctggcaacgcttttc
aaggaccgcggcctgtcggtcagccgcattgcccgcggcctgccggtcggcggcgagctt
gagcacgtcgatgccggcacgctggcgcaggccttgtacgagcgtcgccggctgtccacg
ggtgacgcctga

DBGET integrated database retrieval system