KEGG   Laribacter hongkongensis: LHK_01068Help
Entry
LHK_01068         CDS       T00884                                 

Gene name
rluC
Definition
RluC (EC:5.4.99.12)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
lhk  Laribacter hongkongensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1030796..1031734)
Genome map
AA seq 312 aa AA seqDB search
MTPPSKDSVTFHTITDDEAGQRLDNWLIKILKGVPKSHVYRIVRGGEVRINKGRCQVDQR
VETGDVVRIPPIRIAERPAATRPVPAAAFPVVFEDDALLVIDKPCGVAVHGGSGVSFGVI
EQLRAARPQAKFLELVHRLDRDTSGLLLIAKKRSALVALHDMIRRNMLDKRYLALGVGRW
NPARKSVKKPLTKYTLPDGERRVRVDEAGGQASHTDFRIVRSFAGHTLIEATLQTGRTHQ
IRVHMQSADCPIAGDDKYGDYATNKDLARQGLKRMFLHAWQLRLQHPLTGQLLEFRAPLP
DELNRFIETLPE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacccccgagcaaagattccgtcaccttccacaccatcaccgacgacgaggccgga
cagcgccttgacaactggctgatcaaaatcctcaagggtgtacccaaaagccacgtttac
cgcatcgtgcgcggcggagaagtccggatcaacaagggacgctgccaggtcgaccagcgg
gtggaaaccggcgacgtcgtacgcatcccgcccatccgcattgccgaacgcccggctgcc
acgcgcccggtaccggccgcggcctttccggtcgtcttcgaagatgatgccctgctggtg
atcgacaaaccttgcggcgttgccgtccacggtggctccggcgtcagcttcggcgtgatc
gagcagctgcgcgctgcccgtccgcaggcaaaattcctggagctggtccaccggctggac
cgcgacacgtccggcctgttgctgatcgccaaaaagcgctcggcactcgtggccctgcac
gacatgatccgccgcaacatgctcgacaaacgctatctggcactcggcgtcggccgctgg
aatccggcccgcaagtcggtcaagaagccgctgaccaaatacaccctgcccgatggcgaa
cgccgggtccgggtagacgaagccggcggccaggcctcgcacaccgatttccgcatcgta
cgcagctttgccggccatactctgatcgaagccaccttgcagaccggccgcacgcaccag
atccgcgtccacatgcagtcggccgactgcccgattgccggcgacgacaaatacggtgac
tacgcaaccaacaaggatctggcccggcagggactcaaacgcatgttcctgcatgcctgg
cagctgcgcctgcaacacccgctgaccggccagctactggaattccgcgccccgctgccg
gacgaactcaaccgtttcatcgagaccctgcccgaatga

DBGET integrated database retrieval system