KEGG   Laribacter hongkongensis: LHK_01112Help
Entry
LHK_01112         CDS       T00884                                 

Gene name
thiL
Definition
(GenBank) ThiL
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lhk  Laribacter hongkongensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LHK_01112 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    LHK_01112 (thiL)
   00640 Propanoate metabolism
    LHK_01112 (thiL)
   00650 Butanoate metabolism
    LHK_01112 (thiL)
  Lipid metabolism
   00071 Fatty acid degradation
    LHK_01112 (thiL)
   00072 Synthesis and degradation of ketone bodies
    LHK_01112 (thiL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LHK_01112 (thiL)
   00310 Lysine degradation
    LHK_01112 (thiL)
   00380 Tryptophan metabolism
    LHK_01112 (thiL)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LHK_01112 (thiL)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LHK_01112 (thiL)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LHK_01112 (thiL)
Enzymes [BR:lhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LHK_01112 (thiL)
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LHK_01112 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1081484..1082668
Genome map
AA seq 394 aa AA seqDB search
MQQEVVIVAAKRTAVGSFCGSLAKIASPDLGSAVIKALLAETGVAAEAVSEVILGQILTA
GTGQNPARQALIKAGLPITTPASSLNVLCGSGLRATHLAAQAIALGDAEIVIAGGQENMS
LAPHLLPGARDGFRMGSAQLLDHMINDALTDAYNHYHMGITAENIAEKYGITREEQDQFA
VLSQNRAEAAQKAGKFEAEITPIMLPQRKGDPVAFATDEFVRHGVTMDVLAKMRPAFKKD
GTVTAGNASGINDGAAAVMLMSARKAAELGLKPMAAVRGYALTGCAPEIMGMGPVSATRK
ALAQAGWTLQDLDLIEANEAFAAQSLGVARELEWDMSKVNVNGGAIAIGHPVGASGARVL
VTLLHEMQRRESRKGLATLCIGGGMGVALAVEAC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagaagtcgttatcgtcgcggccaaacgtactgccgttggctcgttttgcgga
tcgctggccaaaattgcttcaccggatcttggctctgccgtaatcaaggctttgctggct
gaaactggcgtggctgctgaagcagtcagtgaagtgattctgggacagatcctgaccgca
gggaccgggcaaaacccggcgcggcaggccttgatcaaggccggtcttccgatcacgact
ccggccagttcgcttaacgtattgtgcggttccggcttgcgtgcaacccatctggctgcc
caggccatcgcattgggtgacgcagaaattgtcatcgcaggcggccaggaaaacatgtcg
ttggctcctcatctgctgcctggcgcacgcgatggtttccgcatgggatctgcccagttg
ctcgatcacatgatcaacgatgccttgaccgatgcgtacaaccactatcacatgggcatt
acggcagagaacatcgccgaaaagtacggtattacccgtgaagagcaagaccagtttgcg
gtcctgtcgcaaaatcgtgccgaagctgcccagaaggctggcaagttcgaagctgaaatc
accccgatcatgcttccgcagcgcaagggcgatcctgttgctttcgccactgacgaattt
gtccgtcacggtgtcacgatggatgttctggccaaaatgcggccggccttcaagaaggat
ggaaccgtcacggccggcaatgcctcgggcatcaatgacggtgctgcagccgtcatgctg
atgtcggctcgcaaagccgctgaactggggctcaagccgatggccgccgtgcgcggttat
gccctgaccggatgtgctccggagatcatgggcatgggaccggtttcggctacccgcaag
gctttggcccaggctggctggacgttgcaggatctggatctgatcgaagcgaacgaagct
tttgccgcgcagtcgctgggagttgcccgtgaactggaatgggacatgagcaaagtcaac
gtcaatggcggtgcaattgccatcggccacccggtcggagcttcgggagcacgcgtgctg
gtgaccctgctgcatgaaatgcagcgtcgcgagtcgcgcaaaggcctggctactctgtgt
atcggcggcggcatgggtgtggccctggctgttgaggcgtgctaa

DBGET integrated database retrieval system