KEGG   Laribacter hongkongensis: LHK_01140Help
Entry
LHK_01140         CDS       T00884                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lhk  Laribacter hongkongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LHK_01140 (speB)
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LHK_01140 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108696..1109658
Genome map
AA seq 320 aa AA seqDB search
MTEIIGDGAFRRPGLYGSTIENTYAGALSFMRRNYTRDLTGVDVAVSGIPLDLAVTFRPG
ARLGPQAVRAASVQLAELKPFPWGFDPFEDLAVVDYGDCWFDAHNPLTIKDSIVNHARTI
INAGARMLTFGGDHYVTYPLLIAHAEKYGKPLSLIHFDAHCDTWPDDSPDSLNHGTMFYK
AVKDGLIDPARSVQVGIRTWNDDFMGIQRLDAPTVHEIGVDETIRRILAIVGDNPTYLTF
DIDCLDPAFAPGTGTPVPGGLTSAQALKIIRNMGDVNLVGMDVVEVSPPFDQSEITAIAA
AHIACDLLCVLRNRKLAGKL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcatcggtgacggtgccttccgtcgtccgggcctgtacggctccactatc
gaaaacacctacgccggcgccctgtctttcatgcgccgcaactacacccgcgacctgacc
ggtgtggacgttgccgtcagcggcattccgctggatctggccgtcaccttccgccccggc
gcccgcctgggaccgcaggcggtgcgggctgccagcgtgcagctggccgagctcaagccg
ttcccgtggggattcgatccgttcgaagacctcgccgtggtggactatggcgactgctgg
ttcgacgcccacaacccgctcaccatcaaggacagcatcgtcaaccatgcccgcaccatc
atcaatgccggtgcccgcatgctgacctttggcggcgaccactacgtcacctatccgctg
ctgatcgcgcacgccgaaaaatacggcaagcccctgtcgctgatccacttcgacgcccac
tgcgacacctggccggatgacagcccggacagcctgaatcacggcaccatgttctacaag
gccgtcaaggatggcctgatcgacccggcccgctcggtgcaggtcggcatccggacctgg
aacgacgacttcatgggtatccagcgactcgacgcacccaccgtgcacgaaatcggcgtg
gatgaaaccatccgccgcatccttgccatcgtgggcgacaacccgacctacctgactttc
gacatcgactgtctcgacccggccttcgcccccggcaccggcacgccggttcctggcggg
ctgaccagcgcccaggccctgaagatcatccgcaacatgggtgacgtgaacctcgtcggc
atggatgtggtggaagtgtcgccgccgttcgaccagagcgaaatcactgccatcgccgcc
gcccacattgcctgtgacctgctgtgcgtcctgcgcaaccgcaagctggccggcaaactg
taa

DBGET integrated database retrieval system