KEGG   Laribacter hongkongensis: LHK_01201Help
Entry
LHK_01201         CDS       T00884                                 

Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lhk  Laribacter hongkongensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LHK_01201
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LHK_01201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157608..1159572)
Genome map
AA seq 654 aa AA seqDB search
MLTPDSLFAVLDTLVGTRRLRPLDRALARFLAGHVPDTPPAVLLATVLASHQLGRGHPAL
DLAAVHADPAATLGWADDGDTPDLTALPVFAGPLSGWLAQLESAACIDRPPADSGAPLVL
AGHNLYLRRYWQCEETVVEAIRARLPQRLAVPDDLSVRLDRLLADMRDADEAARRQTHWQ
SVAVALAARLGFCIISGGPGTGKTTTVVRLLGLLQGLTLDAGRTPLAIRLAAPTGKAAAR
LQDSIRQAVARLDPAVREHVPAEVSTLHRLLGPLPDSRHFRHHAGQPLPLDVLVIDEASM
IDLEMMAAVLSALPAHARLILLGDKDQLASVEAGAVLGSLCAGSRVDVQDPAQWAGSHEM
AAWLGAASGYAVKADGLPAGALTDHVVVLKKSHRFGDDSGIGELARAVNDGDASRAATVW
PRHADSIARLEPASRCIEQLALQGRSSGSPAGWQAASYRAYLEIMAAGDQGDPDGWARQV
LEAFNRFRVLCALRQGEEGVSGVNAAIEASLRTAGLLPAGRSEWYAGRPVMVLKNDYGLG
LMNGDTGIALPMPDATLRVCFALPDGRVRQVLPSRLTDVESAFAMTVHKSQGSEFSHTVL
LLPQHDSPILTRELVYTGITRARDRLTLVGSADIFRRAVSRRTVRHSGLAQRLG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcctgattccctgtttgccgtactggacaccctggtcgggactcgccgcctg
cgtccgctggaccgggcgctggcccgctttctggccggacacgtaccggacaccccgccg
gccgtcctgctggccaccgtactggccagccaccagctggggcgcggccatccggcgctg
gacctggccgccgtccatgccgacccggccgccacgctgggctgggccgacgatggcgat
acgccggacctgacggccttgccggtatttgccgggccgctgtccggctggctggcgcag
ctcgaaagtgccgcctgtatcgaccggccgccggccgacagcggtgcgccgctggtgctg
gccggccacaacctgtacctgcgccgctactggcagtgcgaggaaaccgtggtggaggcc
atccgcgcccgcctgccgcagcgcctggcggtgccggacgacctgtccgtccggctggac
cggctgctggccgacatgcgtgatgccgacgaagcggcccgccgccagacccactggcag
tcggtggcggtggcactggcggcccggctggggttctgcatcatttccggcggtccgggc
accggcaagaccaccacggtggtccgcctgctgggcctgttgcagggactgacgctggat
gccggcaggacgccgctcgcaatccggctggctgcccccaccggcaaggcggcggcccgc
ttgcaggattcgatccgccaggcggtggcccggcttgacccggccgtccgcgagcatgtc
cccgccgaggtgtcgaccctgcaccggctgctgggcccgctgccggacagccggcatttc
cgtcaccatgccggccagccgctgccgctggacgtgctggtgatcgacgaagcctcgatg
atcgaccttgaaatgatggccgcggtgctctcggccctgccggcccatgcccggctgatc
ctgctgggcgacaaggaccagctggcttcggtcgaggccggtgccgtgctgggcagcctg
tgcgccggcagccgggtggatgtgcaggatccggcgcaatgggccggcagccacgaaatg
gcagcctggctgggcgcggccagcggctatgcggtcaaggccgacggcctgccagccgga
gcgctgaccgaccatgtggtggtattgaaaaagagccaccgcttcggggacgacagcggc
atcggcgagctggcccgcgcggtgaacgacggcgatgcctcgcgggcggccaccgtgtgg
ccgcgtcacgccgacagcatcgcccggctggagccggcttcccgctgcatcgaacagctg
gcgctacagggccgcagcagtggcagcccggcaggctggcaggccgccagttaccgcgcc
tatctggaaatcatggccgccggcgaccagggcgatcccgacggctgggcgcgccaggtg
ctggaggcgttcaaccgcttccgggtgctgtgtgccctgcgccagggcgaggaaggcgtc
agcggcgtcaatgccgccatcgaggccagcctgcgcacagccgggctgctgccggccggt
cgcagcgaatggtatgccggccgcccggtgatggtgctgaaaaacgattacggactcggg
ctgatgaacggcgacaccggcattgccctgccgatgcccgacgccacgctgcgcgtgtgc
tttgccctgcccgacggccgggtacgccaggtattgcccagccggctgaccgacgtggaa
agcgcgtttgccatgacggtccacaagtcacagggatcggaattcagccacaccgtcttg
ctgctgccgcagcacgacagcccgatcctgacccgcgagctggtgtataccggcatcacc
cgcgcccgtgaccggctgacactggtgggcagtgccgacattttccggcgtgccgtcagc
cgccgcaccgtccgccacagcggactggcccagcggctgggctag

DBGET integrated database retrieval system