KEGG   Laribacter hongkongensis: LHK_01225Help
Entry
LHK_01225         CDS       T00884                                 

Gene name
acsA
Definition
(GenBank) AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00620  Pyruvate metabolism
lhk00640  Propanoate metabolism
lhk00680  Methane metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_01225 (acsA)
   00620 Pyruvate metabolism
    LHK_01225 (acsA)
   00640 Propanoate metabolism
    LHK_01225 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LHK_01225 (acsA)
Enzymes [BR:lhk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LHK_01225 (acsA)
Lipid biosynthesis proteins [BR:lhk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LHK_01225 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACO74216
UniProt: C1D6V9
Position
complement(1186571..1188532)
Genome map
AA seq 653 aa AA seqDB search
MSTIESVLKETRSFPPSEAFRQQATVSGMQAYNDLCEKANADYEGFWADLARELLSWKKP
FTQVFDGSQAPFFKWFADGQLNVSYNCLDRHLEHNANKTAIIYETDDGQVTPISYRSLYE
QVCQFANGLKSLGVGKGDRVVIYMPMVPQAIVAMQACARIGAIHSVVFGGFSAGALRDRI
QDAAAKVVITANESVRGGKLVPLKATVDEALAMDGCDSIEKVVVLQRTYTPCSMGARDIT
WDALTAGQPLECEPEWMSAEDPLFILYTSGSTGKPKGIQHSSAGYLLGAANSFRWAFDYK
PNDIYWCTADVGWITGHSYICYGPLAMGATQVVFEGIPTYPDAGRFWRMIEQHKVNIFYT
APTAIRSLIKLGADLPKQFDLSSLRVLGTVGEPINPEAWMWYYEVVGGGRCPIVDTWWQT
ETGSAMIAPMPGAVATKPGSCTLPLPGIMADIVDESGAQVEPGRGGFLVIKKPFPSLVRT
IWNDPDRFKKTYFPEEFNGQYYLAGDSANRDESGYFWIMGRIDDVLNVSGHRLGTMEIES
ALVANPLVAEAAVVGKPHDVKGEAVVAFVVLKGIRPEGDEAKKVAAELKSWVAHEIGKIA
QPDDIRFGENLPKTRSGKIMRRLLRSIAKGEEITQDTSTLENPQILDQLQEIA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatcgagtccgtcctcaaggaaacccgcagcttcccgccgagcgaagccttc
cgccagcaagccaccgtttccggcatgcaggcctacaacgacttgtgcgaaaaagccaac
gccgactacgagggattctgggccgatctggcgcgcgaactgctgagctggaaaaagccg
tttacccaagtattcgacggctcccaggcaccgttcttcaagtggtttgccgacggccag
ctcaacgtgtcctacaactgccttgaccggcacctggaacacaacgccaacaagaccgcc
atcatttatgaaaccgacgatggccaggtcaccccgatcagctaccgctcgctgtacgag
caggtatgccagtttgccaacggcctcaagagccttggcgttggcaaaggcgaccgcgtc
gtgatctacatgccgatggtgccacaggccatcgtggccatgcaggcctgcgcccgcatc
ggtgccatccattcggtcgtgttcggcggcttttctgccggcgccctgcgcgaccgtatc
caggatgctgccgccaaggtcgtgatcacggccaacgaaagcgtgcgcggaggcaagctc
gttccgctcaaggccacggtggacgaggcactggccatggacggctgcgacagcatcgaa
aaagtggtggtactccagcgcacctataccccttgcagcatgggtgccagggacattacc
tgggacgcactgacggccggccagccgctggaatgcgaaccggaatggatgagcgccgaa
gatccgctgttcatcctgtacacctccggctccaccggcaaacccaaaggcatccagcac
agctcggccggttacctgctcggtgccgccaacagcttccgctgggcctttgactacaag
cccaacgacatttactggtgcacggccgacgtgggctggattaccggtcactcctacatc
tgctatggcccgctggccatgggtgccacccaggtcgtgttcgaaggcatcccgacctat
ccggatgccggtcgcttctggcgcatgatcgagcagcacaaggtcaacattttctacacc
gcaccgaccgccatccgctcgctgatcaagctcggcgccgacctgcccaaacagttcgac
ctctccagcttgcgcgtgcttggtaccgtcggcgaaccgatcaacccggaagcctggatg
tggtactacgaagtggtcggcggcggccgctgcccgatcgtggacacctggtggcaaacc
gaaaccggctcggccatgattgccccgatgccgggtgccgttgccaccaagccgggcagt
tgcaccctgccgctgccgggcatcatggccgacatcgttgacgaatccggtgcccaggtc
gaaccgggacgcggtggcttcctcgtcatcaaaaagccgttcccgagccttgtccgcact
atctggaacgatccggaccgcttcaagaaaacctacttcccggaagagttcaacggccag
tactacctggcgggtgactcggccaaccgtgacgaaagcggttatttctggatcatgggc
cgcattgacgacgtcctgaacgtgtccggccaccgtctgggcaccatggaaatcgaatcg
gcactggtcgccaacccgctggtcgccgaagcagctgtcgtcggcaagcctcacgacgtc
aagggtgaggccgtggtggccttcgtggtactcaagggcatccgtccggaaggcgacgaa
gccaagaaggtggcggccgaactcaagagctgggtagcccacgaaatcggcaagatcgcc
cagccggacgacatccgctttggcgaaaacctgcccaagacccgttccggcaagatcatg
cgccgcctgttgcgctcgatcgccaagggcgaggaaatcacccaggatacctcgacgctg
gaaaacccgcagatccttgaccagcttcaggaaattgcctga

DBGET integrated database retrieval system