KEGG   Laribacter hongkongensis: LHK_01251Help
Entry
LHK_01251         CDS       T00884                                 

Gene name
trpB
Definition
(GenBank) TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LHK_01251 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_01251 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LHK_01251 (trpB)
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LHK_01251 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1211879..1213078
Genome map
AA seq 399 aa AA seqDB search
MQIYDQPDARGHFGPYGGVFVAETLMAALDALRQEYESARQDPAFMAEFHYELKHYVGRP
SPVYHARRLSEACGGAQIWLKREDLNHTGAHKINNAIGQALLARRMGKKRVIAETGAGQH
GVATATVAARYGMECVVYMGAEDVKRQAPNVFRMKLLGATVVPVESGSRTLKDALNEAMR
DWVTNVDNTFYILGTAAGPHPYPMLVRDFVSVIGQEALVQMPEVIGRQPDAVVACVGGGS
NAIGMFHPYVDVPGVRMVGVEAGGDGVETGRHAAPLSAGRPGVLHGARMYLMQDADGQII
ETHSISAGLDYPGVGPEHSYLKDIGRAEYVAATDTEALEAFHTLCRLEGIIPALESSHAV
AHAMKMAAGMSPEQVILVNLSGRGDKDINTVARLAGIEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttatgaccagcccgatgcgcgcggtcacttcggcccgtatggcggagtgttt
gtcgctgaaacgctgatggccgcactggatgccttgcggcaggaatacgaatccgcccgc
caggacccggccttcatggccgagttccattacgagctcaagcattatgtcggacggcca
agcccggtgtaccacgcccgccgcctgtcggaagcgtgcggcggtgcccagatctggctc
aagcgcgaagacctcaaccataccggcgcccacaagatcaacaacgccatcggccaggcc
ctgctggcgcggcgcatgggcaaaaagcgggtgatcgccgaaaccggcgctggccagcat
ggcgtggcaaccgccaccgtggctgcccgctacggcatggagtgcgtggtgtacatgggt
gccgaggacgtcaagcgccaggcacccaatgtcttccgcatgaagctcctgggggcgacg
gtggtgccggtggaaagcggcagccggaccctgaaggacgcgctcaacgaagccatgcgc
gactgggtcaccaacgtcgacaacacgttctacatcctcggcacggcagccggtccgcac
ccgtatccgatgctggtgcgtgatttcgtgtcggtgatcggccaggaagcactggtgcag
atgcccgaggtgatcggtcgccagccggatgccgtggttgcctgtgtcggtggcggttcc
aacgccatcggcatgttccatccgtatgtcgacgtaccgggcgtgcgcatggtcggtgtc
gaagccggtggcgacggtgtcgagaccgggcgtcatgcggcgccgctgtcggcagggcgc
ccgggcgtcctgcacggtgcacgcatgtacctgatgcaggatgccgacggccagatcatc
gaaacccattcgatctcggccgggctggattaccccggcgtgggcccggagcacagctac
ctcaaggacatcggtcgtgccgaatatgtggccgctaccgataccgaagccctggaggca
ttccataccctgtgccggctggaaggcatcattccggcgctggaatccagccatgccgtg
gcccatgccatgaagatggcggccggcatgtcgccggagcaggtgattctggtcaatctc
tccggccggggcgacaaggacatcaacaccgtcgcgcgactggcgggcatcgaactgtga

DBGET integrated database retrieval system