KEGG   Laribacter hongkongensis: LHK_01252Help
Entry
LHK_01252         CDS       T00884                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00260  Glycine, serine and threonine metabolism
lhk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01130  Biosynthesis of antibiotics
lhk01230  Biosynthesis of amino acids
Module
lhk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_01252 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LHK_01252 (trpA)
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LHK_01252 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Peripla_BP_6 Peptidase_M15_3
Motif
Other DBs
NCBI-ProteinID: ACO74242
UniProt: C1D702
Position
1213086..1213880
Genome map
AA seq 264 aa AA seqDB search
MNRIDERLAALKAAGRKALIPFITAGDPEPDMTVSLMHALVRGGADVIELGIPFSDPMAD
GPVIQRASERALARGMTLARVLEMVAGFRRTDPDTPVVLMGYLNPVEAMGYAAFASAARA
AGVDGVLTVDCPPEESDEYAQVLQSHGLATVFLVAPTTPAARLAAVARLARGYVYYVSIK
GVTGAATLDVADVARQVGALREHLSLPVGVGFGIRDAETARAIGEVADAVVIGSRLVQEI
EAAGAQAPDRLQALLAGIRQALDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtatcgacgaacgactggccgcgctcaaggccgcaggccgcaaggccctgatc
ccgttcattaccgccggcgacccggagccggacatgaccgtcagcctgatgcacgccctg
gtgcgtggcggggccgacgtgattgaactgggcattccgttctcggacccgatggcagac
ggcccggtgatccagcgcgccagtgaacgggcactggcccggggcatgacgctggcgcgg
gtgctggaaatggtggccggattccgccgcaccgatccggacaccccggtggtgctgatg
ggctatctgaatccggtcgaagccatgggctatgccgcgtttgccagtgctgcgcgtgcg
gccggggtggatggcgtgctgacggtggattgcccgcccgaagaatcggacgagtacgca
caggtgctgcaatcgcacggcctggcgacggtgttcctcgtggcacccacgacaccggcg
gcccgtctggccgctgtggcgcggctggcgcggggctatgtctactatgtctccatcaag
ggcgtgaccggtgccgccacgctggacgtggccgacgtggcccgccaggtcggggcattg
cgcgagcatctgtcgctgccggtcggtgtgggcttcggcatccgtgatgccgaaacggca
cgggccatcggcgaagtggccgatgcggtggtgatcggttcgcggctggtgcaggaaatc
gaagcggccggtgcgcaggcacctgaccgtttgcaggcactgcttgccggcatccgccag
gcactggacgcctga

DBGET integrated database retrieval system