KEGG   Laribacter hongkongensis: LHK_01252Help
Entry
LHK_01252         CDS       T00884                                 

Gene name
trpA
Definition
(GenBank) TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LHK_01252 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_01252 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LHK_01252 (trpA)
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LHK_01252 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1213086..1213880
Genome map
AA seq 264 aa AA seqDB search
MNRIDERLAALKAAGRKALIPFITAGDPEPDMTVSLMHALVRGGADVIELGIPFSDPMAD
GPVIQRASERALARGMTLARVLEMVAGFRRTDPDTPVVLMGYLNPVEAMGYAAFASAARA
AGVDGVLTVDCPPEESDEYAQVLQSHGLATVFLVAPTTPAARLAAVARLARGYVYYVSIK
GVTGAATLDVADVARQVGALREHLSLPVGVGFGIRDAETARAIGEVADAVVIGSRLVQEI
EAAGAQAPDRLQALLAGIRQALDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtatcgacgaacgactggccgcgctcaaggccgcaggccgcaaggccctgatc
ccgttcattaccgccggcgacccggagccggacatgaccgtcagcctgatgcacgccctg
gtgcgtggcggggccgacgtgattgaactgggcattccgttctcggacccgatggcagac
ggcccggtgatccagcgcgccagtgaacgggcactggcccggggcatgacgctggcgcgg
gtgctggaaatggtggccggattccgccgcaccgatccggacaccccggtggtgctgatg
ggctatctgaatccggtcgaagccatgggctatgccgcgtttgccagtgctgcgcgtgcg
gccggggtggatggcgtgctgacggtggattgcccgcccgaagaatcggacgagtacgca
caggtgctgcaatcgcacggcctggcgacggtgttcctcgtggcacccacgacaccggcg
gcccgtctggccgctgtggcgcggctggcgcggggctatgtctactatgtctccatcaag
ggcgtgaccggtgccgccacgctggacgtggccgacgtggcccgccaggtcggggcattg
cgcgagcatctgtcgctgccggtcggtgtgggcttcggcatccgtgatgccgaaacggca
cgggccatcggcgaagtggccgatgcggtggtgatcggttcgcggctggtgcaggaaatc
gaagcggccggtgcgcaggcacctgaccgtttgcaggcactgcttgccggcatccgccag
gcactggacgcctga

DBGET integrated database retrieval system