KEGG   Laribacter hongkongensis: LHK_01397Help
Entry
LHK_01397         CDS       T00884                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lhk  Laribacter hongkongensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LHK_01397
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LHK_01397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347618..1348100
Genome map
AA seq 160 aa AA seqDB search
MTLAAIALGANLGDAAASVRDAMQALAALPDTRWLAGSPLYRTAPVGYADQPDFVNAVAL
VETGLTPQELLAALQKLEEQGGRVRSFRNAPRTLDLDLLVYGEVQLDTPELTLPHPRMHE
RTFVLMPLADVAPDLLIPGCGRVADCLAGLPVNGIEKLAG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggccgccattgcgctgggggccaatctgggagatgccgcggccagcgtgcgc
gacgccatgcaggcgctggctgcgctgccggacacgcgctggctcgccgggtcgccgctg
taccgtacggcgccggtaggctatgccgaccagccggattttgttaacgctgttgctttg
gtggagaccgggctgacgccgcaggagctgctggctgcgctgcaaaaactggaagagcag
ggtggccgtgtacgttcattccgcaatgctccgcgcacgctggacctcgacctgctggtc
tacggcgaagtgcaactggatacgccggagctgacgctgccgcatccgcgcatgcacgag
cggacttttgtgctgatgcccctggctgatgtggctcctgacctgctgattccggggtgc
gggcgggtggccgactgtctggccggattgccggtcaacggcatcgaaaagcttgccggt
tga

DBGET integrated database retrieval system