KEGG   Laribacter hongkongensis: LHK_01415Help
Entry
LHK_01415         CDS       T00884                                 

Gene name
holC
Definition
HolC (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lhk  Laribacter hongkongensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lhk00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lhk00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:lhk03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lhk03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lhk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367525..1367947
Genome map
AA seq 140 aa AA seqDB search
MTRVDFYHHVADPLSFACKLTRTVIGKGERLTVLFADEAALGAFDTRLWSVPAQGFVPHV
RLDDPLAAETPVLLATSLPEVPPTGVLLNLSLGEPAGFPAWPRILEIVGEDAGQLDRARE
VARAYKRAGLDTVYHDMTGK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggttgatttttaccaccacgtcgccgatccgctttcctttgcctgcaagctc
acccgcacggtgatcggcaagggggagcggctgacggtcctgtttgccgacgaggctgca
ctgggggcattcgatacccggttgtggtcggtgccggcgcaaggttttgtgccgcatgtg
cggctggacgatccgctggcagcagaaacgccggtcttgctggccacctccctgccggag
gtgccgccaaccggcgtgctgctgaacctttccctgggagagccggccggtttcccggcg
tggccgcgcatcctggagattgtcggcgaggatgccggtcagctggatcgcgcccgtgag
gtggcccgggcctacaaacgtgccgggctggatacggtttaccacgacatgacgggcaaa
tag

DBGET integrated database retrieval system