KEGG   Laribacter hongkongensis: LHK_01415Help
Entry
LHK_01415         CDS       T00884                                 

Gene name
holC
Definition
(GenBank) HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00230  Purine metabolism
lhk00240  Pyrimidine metabolism
lhk01100  Metabolic pathways
lhk03030  DNA replication
lhk03430  Mismatch repair
lhk03440  Homologous recombination
Module
lhk_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LHK_01415 (holC)
   00240 Pyrimidine metabolism
    LHK_01415 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LHK_01415 (holC)
   03430 Mismatch repair
    LHK_01415 (holC)
   03440 Homologous recombination
    LHK_01415 (holC)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LHK_01415 (holC)
DNA replication proteins [BR:lhk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     LHK_01415 (holC)
DNA repair and recombination proteins [BR:lhk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     LHK_01415 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ACO74405
UniProt: C1D7G5
Position
1367525..1367947
Genome map
AA seq 140 aa AA seqDB search
MTRVDFYHHVADPLSFACKLTRTVIGKGERLTVLFADEAALGAFDTRLWSVPAQGFVPHV
RLDDPLAAETPVLLATSLPEVPPTGVLLNLSLGEPAGFPAWPRILEIVGEDAGQLDRARE
VARAYKRAGLDTVYHDMTGK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggttgatttttaccaccacgtcgccgatccgctttcctttgcctgcaagctc
acccgcacggtgatcggcaagggggagcggctgacggtcctgtttgccgacgaggctgca
ctgggggcattcgatacccggttgtggtcggtgccggcgcaaggttttgtgccgcatgtg
cggctggacgatccgctggcagcagaaacgccggtcttgctggccacctccctgccggag
gtgccgccaaccggcgtgctgctgaacctttccctgggagagccggccggtttcccggcg
tggccgcgcatcctggagattgtcggcgaggatgccggtcagctggatcgcgcccgtgag
gtggcccgggcctacaaacgtgccgggctggatacggtttaccacgacatgacgggcaaa
tag

DBGET integrated database retrieval system