KEGG   Laribacter hongkongensis: LHK_01415Help
Entry
LHK_01415         CDS       T00884                                 

Gene name
holC
Definition
HolC (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lhk  Laribacter hongkongensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LHK_01415 (holC)
   00240 Pyrimidine metabolism
    LHK_01415 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LHK_01415 (holC)
   03430 Mismatch repair
    LHK_01415 (holC)
   03440 Homologous recombination
    LHK_01415 (holC)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LHK_01415 (holC)
DNA replication proteins [BR:lhk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     LHK_01415 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367525..1367947
Genome map
AA seq 140 aa AA seqDB search
MTRVDFYHHVADPLSFACKLTRTVIGKGERLTVLFADEAALGAFDTRLWSVPAQGFVPHV
RLDDPLAAETPVLLATSLPEVPPTGVLLNLSLGEPAGFPAWPRILEIVGEDAGQLDRARE
VARAYKRAGLDTVYHDMTGK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggttgatttttaccaccacgtcgccgatccgctttcctttgcctgcaagctc
acccgcacggtgatcggcaagggggagcggctgacggtcctgtttgccgacgaggctgca
ctgggggcattcgatacccggttgtggtcggtgccggcgcaaggttttgtgccgcatgtg
cggctggacgatccgctggcagcagaaacgccggtcttgctggccacctccctgccggag
gtgccgccaaccggcgtgctgctgaacctttccctgggagagccggccggtttcccggcg
tggccgcgcatcctggagattgtcggcgaggatgccggtcagctggatcgcgcccgtgag
gtggcccgggcctacaaacgtgccgggctggatacggtttaccacgacatgacgggcaaa
tag

DBGET integrated database retrieval system