KEGG   Laribacter hongkongensis: LHK_01493Help
Entry
LHK_01493         CDS       T00884                                 

Gene name
algC
Definition
AlgC (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_01493 (algC)
   00030 Pentose phosphate pathway
    LHK_01493 (algC)
   00051 Fructose and mannose metabolism
    LHK_01493 (algC)
   00052 Galactose metabolism
    LHK_01493 (algC)
   00500 Starch and sucrose metabolism
    LHK_01493 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    LHK_01493 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    LHK_01493 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LHK_01493 (algC)
Enzymes [BR:lhk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LHK_01493 (algC)
    5.4.2.8  phosphomannomutase
     LHK_01493 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1451230..1452102)
Genome map
AA seq 290 aa AA seqDB search
MNIVVDCGNGVPGAFAPNLYRHLGCRVRELFCDVDGTFPNHHPDPAKPENLQDLIHALAT
TDAELGLAFDGDGDRLGVVTKDGQIIYPDRQLMLFAGDVLSRNDGAKVIFDVKSTRKLAP
WIREMGGEPIMSRTGHSFIKARMKETGALLAGEMSGHVFFKERWYGFDDGLYAGARLLEI
LSQVDDPSAVLNNLPNSLSTPELNLKMTEGEHYALISRLQENARFEGADEVITLDGLRVE
YPDGFGLARASNTTPVIVLRFEADTPEALARIQADFRRVLSAETDAVLPF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtggtcgattgcggcaacggcgtacccggcgcctttgcacccaatctctac
cggcatctgggctgccgcgtgcgcgagctcttctgcgacgtggacggtacctttcccaac
catcaccccgacccggccaagccggaaaacctgcaagacctgatccatgcactggctacc
actgatgccgagctgggtctggcgtttgacggcgacggcgaccgcttgggcgtggtcacc
aaggacgggcagatcatttatccggaccgccagctgatgctgtttgccggtgacgtactg
tcgcgcaacgatggtgccaaagtgatctttgacgtcaagtccacgcgcaagctggcaccg
tggattcgtgaaatgggcggtgaaccgatcatgtcacgcaccggccacagcttcatcaag
gcccgcatgaaggaaaccggtgccctgctggccggagaaatgtccggtcacgtgtttttc
aaggaacgctggtacggctttgatgacggcctctatgccggggcccgcctgctggaaatc
ctgtcgcaggttgatgaccccagtgccgtgctgaacaacctgccaaacagcctcagcacg
cccgaactgaacctgaaaatgaccgaaggcgagcattacgccctgatcagtcgcctgcag
gaaaatgcccgctttgaaggggcggacgaggtcattaccctcgacggactgcgggtggag
taccccgacggctttggccttgcccgggcatccaacaccacaccggtcatcgtactgcgc
ttcgaggccgacacgcctgaggcactggcccgtatccaggccgatttccgccgggtactg
agtgccgagacagacgccgtactgccgttctga

DBGET integrated database retrieval system