KEGG   Laribacter hongkongensis: LHK_01493Help
Entry
LHK_01493         CDS       T00884                                 

Gene name
algC
Definition
(GenBank) AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00030  Pentose phosphate pathway
lhk00051  Fructose and mannose metabolism
lhk00052  Galactose metabolism
lhk00230  Purine metabolism
lhk00500  Starch and sucrose metabolism
lhk00520  Amino sugar and nucleotide sugar metabolism
lhk00521  Streptomycin biosynthesis
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_01493 (algC)
   00030 Pentose phosphate pathway
    LHK_01493 (algC)
   00051 Fructose and mannose metabolism
    LHK_01493 (algC)
   00052 Galactose metabolism
    LHK_01493 (algC)
   00500 Starch and sucrose metabolism
    LHK_01493 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    LHK_01493 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    LHK_01493 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LHK_01493 (algC)
Enzymes [BR:lhk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     LHK_01493 (algC)
    5.4.2.8  phosphomannomutase
     LHK_01493 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACO74482
UniProt: C1D7P2
Position
complement(1451230..1452102)
Genome map
AA seq 290 aa AA seqDB search
MNIVVDCGNGVPGAFAPNLYRHLGCRVRELFCDVDGTFPNHHPDPAKPENLQDLIHALAT
TDAELGLAFDGDGDRLGVVTKDGQIIYPDRQLMLFAGDVLSRNDGAKVIFDVKSTRKLAP
WIREMGGEPIMSRTGHSFIKARMKETGALLAGEMSGHVFFKERWYGFDDGLYAGARLLEI
LSQVDDPSAVLNNLPNSLSTPELNLKMTEGEHYALISRLQENARFEGADEVITLDGLRVE
YPDGFGLARASNTTPVIVLRFEADTPEALARIQADFRRVLSAETDAVLPF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtggtcgattgcggcaacggcgtacccggcgcctttgcacccaatctctac
cggcatctgggctgccgcgtgcgcgagctcttctgcgacgtggacggtacctttcccaac
catcaccccgacccggccaagccggaaaacctgcaagacctgatccatgcactggctacc
actgatgccgagctgggtctggcgtttgacggcgacggcgaccgcttgggcgtggtcacc
aaggacgggcagatcatttatccggaccgccagctgatgctgtttgccggtgacgtactg
tcgcgcaacgatggtgccaaagtgatctttgacgtcaagtccacgcgcaagctggcaccg
tggattcgtgaaatgggcggtgaaccgatcatgtcacgcaccggccacagcttcatcaag
gcccgcatgaaggaaaccggtgccctgctggccggagaaatgtccggtcacgtgtttttc
aaggaacgctggtacggctttgatgacggcctctatgccggggcccgcctgctggaaatc
ctgtcgcaggttgatgaccccagtgccgtgctgaacaacctgccaaacagcctcagcacg
cccgaactgaacctgaaaatgaccgaaggcgagcattacgccctgatcagtcgcctgcag
gaaaatgcccgctttgaaggggcggacgaggtcattaccctcgacggactgcgggtggag
taccccgacggctttggccttgcccgggcatccaacaccacaccggtcatcgtactgcgc
ttcgaggccgacacgcctgaggcactggcccgtatccaggccgatttccgccgggtactg
agtgccgagacagacgccgtactgccgttctga

DBGET integrated database retrieval system