KEGG   Laribacter hongkongensis: LHK_01603Help
Entry
LHK_01603         CDS       T00884                                 

Gene name
dsbC
Definition
DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LHK_01603 (dsbC)
Secretion system [BR:lhk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   LHK_01603 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1548749..1549480
Genome map
AA seq 243 aa AA seqDB search
MLRLRPLAAFMLAIPLLACAAGTADNTDSVRQAFEKKFPQRQVQAVRATPVTGIYEIVLP
DRQVVYADAKVKHLFVGDLIDVDARQSLTEARVAELSKVDWKNLPLDLAFKEVRGNGSRK
LAVFSDPDCPFCKRLERDSLKGVANVTIYTFLYPLTSLHPDAMHKSAQILCSSNPQVAWS
DFMLNDKPLAGDGKCAAADKLASIQQLAEKLGISGTPALVFPNGQLVSGAIPKADVEKLL
NSK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctccgacttcgcccccttgccgccttcatgctggcgattccgttgctggcctgcgcg
gccgggactgctgacaacaccgacagcgtacggcaggcattcgagaaaaaatttccgcag
aggcaggtgcaggccgtgcgggctacgccggtaaccggcatttacgaaatcgtgctgccg
gaccggcaggttgtctatgccgatgccaaggtcaaacacctgtttgtcggagacctgatt
gatgttgatgcccgccagagcctgaccgaagctcgtgtggccgaactctccaaagttgac
tggaaaaacctgcccctcgacctggctttcaaggaagtgcgtggcaatggcagccgcaag
cttgccgtgttttccgacccggactgcccgttctgcaagcggctggaacgcgacagcctc
aagggtgtcgccaacgtgacgatttataccttcctgtatccgctgacctcactgcatccg
gacgccatgcacaagtcggcccagatcctgtgcagcagcaatccgcaggtggcctggtct
gacttcatgctcaatgacaagcccctggccggagacggcaaatgtgccgcagccgacaag
ctggcctccatccagcaactggccgaaaaactgggcatcagcggcacacctgccctagta
tttcccaatggccagctggtctccggcgccattcccaaggcagacgtggaaaaactgctc
aacagcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system