KEGG   Laribacter hongkongensis: LHK_01710Help
Entry
LHK_01710         CDS       T00884                                 

Gene name
rbsK
Definition
RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lhk  Laribacter hongkongensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LHK_01710 (rbsK)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LHK_01710 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634620..1635513
Genome map
AA seq 297 aa AA seqDB search
MPKIVVVGSINMDLVVLTSRYPEIGETLTGEGFMTFAGGKGANQAVAASRLGSSVVMLGC
VGNDAFGRELSARLLNEGVDTAWVDVIEEVETGVAAITVAGGDNAIVVIPGANHRLSEAH
VQAAERVIRDADVVLSQLEVPMPTVLAAARMARKHGKPFILNPAPAQKLPGELLDLVTLI
TPNEFELATALGCKGADYTELLDFLPGRVAMTRGAHGAFYSCSSGTLHHQPSFAVEVVDT
TGAGDTFNAALATFWHLGLAEAIRRACAAAALSVTRLGAQGGMPTLSELDDFLARQA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaatcgttgtggtcggcagcatcaacatggatctggtggtgctgacttcccgc
tatcccgaaatcggcgaaaccctgacgggtgaaggtttcatgacctttgccggtggcaag
ggagccaatcaggctgtagcggcctcccgtctggggagttcggtcgtcatgctgggctgt
gtcggcaacgatgccttcgggcgcgagctgtcagccaggctgctgaacgaaggcgtcgat
accgcctgggtggatgtcatcgaagaagtggaaaccggtgttgcagccattaccgttgcc
ggcggcgacaatgccatcgtcgtcattccgggggccaatcatcgcctgtcggaagcgcat
gtccaagcagccgaacgggtcatccgtgatgccgacgtcgtgctctcgcagctcgaggtt
cccatgccgacagtgctggcggccgcgcgcatggccaggaaacacggcaagccgttcatc
ctcaatccggctccggcccagaaactgccgggtgaactgctggacctcgtgaccctgatt
acgcccaacgaattcgagctggccaccgcactgggctgcaagggcgcggactacaccgaa
ctcctcgacttcctgcccggacgcgtggccatgacccgtggcgcgcacggtgctttttat
tcgtgcagcagcggcaccctccatcaccagccgagctttgccgtggaagtcgtggatacc
accggtgccggcgataccttcaatgcggcactggctacgttctggcatctggggctggca
gaagccatccgccgtgcttgcgctgccgcggccctgtccgtgacccgcctgggcgcgcag
ggcggcatgcccaccttgtccgagctggacgattttcttgcccgacaggcctga

DBGET integrated database retrieval system