KEGG   Laribacter hongkongensis: LHK_01719Help
Entry
LHK_01719         CDS       T00884                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LHK_01719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1641239..1642054
Genome map
AA seq 271 aa AA seqDB search
MAFSQPAVLLVHGLGGTTYDLGALGKTLENAGFVTHSPLLPGHGSLPADLLRTHWQDWVE
AIRLSYRELKARHGAVHLAGVCLGGLVALEVARLEKHDGRLALYAPPMFLDGWSLPRLTW
ARHIVYRIPGLARRMRVPENEPFGIKNPRLRKIIQQRFERGEGFHYAYVPLACIREVDRL
RRHLRQRLAEICCPTLIVHADEDDITSPRSAHYLMNRLGGSVEFMPLTDSYHMIMVDNER
NQVLARSRSFFGSSCNPAIPDQPSPEMRVAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctttttcgcagccggctgttttactggttcatggactgggcgggacgacgtacgac
ttgggagcgctaggcaaaacgctggaaaatgccggttttgtcacccactctccactcctg
ccagggcatggcagcttgcccgctgatttgctcaggactcactggcaggactgggttgaa
gccatccgcctcagctaccgcgaactcaaggccaggcatggcgcagtacatctggccggc
gtgtgtctgggaggattggtggcactcgaagtcgcccggctggagaagcacgatggccgc
ctggccctctatgctcctcccatgtttctggatggctggagcctgccgcgactgacctgg
gcgcggcacatcgtctaccgcattcccgggctggccaggcgcatgcgcgtaccggaaaac
gagccgttcggcatcaagaaccctcgtttgcgcaagatcatccagcagcgtttcgagcgc
ggagaaggattccactacgcatatgtaccgctggcctgtattcgcgaagtagaccgcttg
cgtaggcatctcaggcagagactggctgaaatctgctgtccgacactgatcgtgcatgca
gatgaagatgacattaccagtcctcgctcggcgcattacctgatgaaccggctgggtggc
tcggtggagttcatgccgctcaccgacagttaccacatgatcatggtcgataacgaacgc
aatcaggtgctggcacgcagccggagcttttttggttcgagctgtaatccggcaataccg
gaccagccctccccggaaatgcgggttgctgcgtaa

DBGET integrated database retrieval system