KEGG   Laribacter hongkongensis: LHK_01752Help
Entry
LHK_01752         CDS       T00884                                 

Definition
Lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     LHK_01752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672798..1673262)
Genome map
AA seq 154 aa AA seqDB search
MRTRQIAAALTLSASALVGIALHEGYRDTAYIPVPGDVPTIGFGTTEGVKMGDRITPPKA
LARALTDVQKFEGALKQCVRVPLHQHEYDAYVSLAYNIGPGAFCGSTLVLKLNAGDYAGA
CAEIDRWVYAGGKRLPGLVKRRAEERARCEGREV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacacgacaaatagccgccgccctgacgttgtcagcatcggcgctggtcggcatt
gccctgcacgagggctaccgtgacacggcatacatcccggtaccgggtgatgtgccgacc
atcggctttggcacgaccgaaggtgtgaagatgggtgaccgcatcacgccgcccaaggca
ctggcccgggcattgaccgacgtgcagaagttcgagggggcgctgaaacaatgcgttcgc
gtgccgcttcatcagcatgaatacgatgcatacgtgtccttggcctacaacatcgggccg
ggagcgttctgcggttcgacgctggtgctgaagctgaatgccggcgattacgctggggca
tgcgccgagattgatcggtgggtctatgcaggggggaaacgcttgcctgggctggtcaag
cgtcgggccgaggaacgggcccggtgtgaagggagggaggtatga

DBGET integrated database retrieval system