KEGG   Laribacter hongkongensis: LHK_01846Help
Entry
LHK_01846         CDS       T00884                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lhk  Laribacter hongkongensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LHK_01846 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LHK_01846 (nagZ)
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LHK_01846 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1754002..1755090)
Genome map
AA seq 362 aa AA seqDB search
MTLQLPRGPVMVDVAGCSLSDDDRRRLSHPMVGAVILFRRNFESVGQLRSLTEEIRSLRS
PHLLIAVDHEGGRVQRFLTGFTRLPPMQALGALWEKSPEAALDLAHDVGEVLATELRASG
VDLSFTPVLDIDHGRCAVIGNRSFHADPNIVATLAEALTRGLVAGGMIACGKHFPGHGAV
EGDSHHVIPVDHRSYASIEEADLIPFARLAAAGMHAVMPAHVVYDAVDPLPAGFSPFWLQ
TVLRERMGFGGTIFSDDLCMEGAAGAGGIAARAQAAFAAGCDMALVCNRPDLADELLAQL
DMPVTPELTGRLAAMAGHGEVADWQQKLDGDAFRAKAAKVAALAATAEPSRILAGPAVGE
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcaacttccccgcggcccggtaatggtcgatgtagctggctgctccttgtct
gatgatgatcgccgccgtttgtcccacccgatggtcggggccgtaatcctgtttcgccgc
aatttcgaatccgtcggacagttacggtcccttaccgaggaaatccgttccttgcgcagt
ccgcatctcctgattgcagttgatcatgaaggtggccgggtccagcgcttcctgaccggt
ttcacccgtttgccgccgatgcaggctctgggggcgttgtgggaaaaatcaccggaggct
gcactggatctggctcatgacgtcggtgaagtgctggcgaccgaattgcgggccagtggt
gtggacctgagctttactccggtacttgacattgaccacggccggtgtgccgtcatcggt
aaccgcagttttcatgcagacccgaacatcgtggcgacccttgccgaagcgctgacccgc
gggctggtggccggaggcatgattgcctgcggcaagcacttccctggccatggggcggtg
gaaggcgattcacatcacgtcatcccggtagaccatcgcagctatgcgtccatcgaagaa
gccgacctgatcccgtttgcccgcctggcagcagccggcatgcatgccgtgatgccggcc
catgtggtctatgacgcagtcgatccgctgcccgccggtttctcgcctttctggttgcag
acagtcttgcgggaacgcatgggctttggcggcacgattttcagtgatgacctctgcatg
gaaggcgcggcaggtgccggggggattgcggcccgggcgcaggcagcttttgcggccggc
tgcgacatggctctggtatgcaaccgtccggacctggctgacgagttgctggcacaactc
gatatgcccgttactcctgaactgaccggacggctggccgcgatggccggtcatggtgag
gttgctgactggcaacaaaagcttgatggtgatgccttccgggccaaggcggccaaggtg
gctgccctggccgctacggcggaaccctcacgtattctggctggcccggcggtcggtgaa
tctgcctga

DBGET integrated database retrieval system