KEGG   Laribacter hongkongensis: LHK_01846Help
Entry
LHK_01846         CDS       T00884                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lhk  Laribacter hongkongensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lhk00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lhk00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1754002..1755090)
Genome map
AA seq 362 aa AA seqDB search
MTLQLPRGPVMVDVAGCSLSDDDRRRLSHPMVGAVILFRRNFESVGQLRSLTEEIRSLRS
PHLLIAVDHEGGRVQRFLTGFTRLPPMQALGALWEKSPEAALDLAHDVGEVLATELRASG
VDLSFTPVLDIDHGRCAVIGNRSFHADPNIVATLAEALTRGLVAGGMIACGKHFPGHGAV
EGDSHHVIPVDHRSYASIEEADLIPFARLAAAGMHAVMPAHVVYDAVDPLPAGFSPFWLQ
TVLRERMGFGGTIFSDDLCMEGAAGAGGIAARAQAAFAAGCDMALVCNRPDLADELLAQL
DMPVTPELTGRLAAMAGHGEVADWQQKLDGDAFRAKAAKVAALAATAEPSRILAGPAVGE
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcaacttccccgcggcccggtaatggtcgatgtagctggctgctccttgtct
gatgatgatcgccgccgtttgtcccacccgatggtcggggccgtaatcctgtttcgccgc
aatttcgaatccgtcggacagttacggtcccttaccgaggaaatccgttccttgcgcagt
ccgcatctcctgattgcagttgatcatgaaggtggccgggtccagcgcttcctgaccggt
ttcacccgtttgccgccgatgcaggctctgggggcgttgtgggaaaaatcaccggaggct
gcactggatctggctcatgacgtcggtgaagtgctggcgaccgaattgcgggccagtggt
gtggacctgagctttactccggtacttgacattgaccacggccggtgtgccgtcatcggt
aaccgcagttttcatgcagacccgaacatcgtggcgacccttgccgaagcgctgacccgc
gggctggtggccggaggcatgattgcctgcggcaagcacttccctggccatggggcggtg
gaaggcgattcacatcacgtcatcccggtagaccatcgcagctatgcgtccatcgaagaa
gccgacctgatcccgtttgcccgcctggcagcagccggcatgcatgccgtgatgccggcc
catgtggtctatgacgcagtcgatccgctgcccgccggtttctcgcctttctggttgcag
acagtcttgcgggaacgcatgggctttggcggcacgattttcagtgatgacctctgcatg
gaaggcgcggcaggtgccggggggattgcggcccgggcgcaggcagcttttgcggccggc
tgcgacatggctctggtatgcaaccgtccggacctggctgacgagttgctggcacaactc
gatatgcccgttactcctgaactgaccggacggctggccgcgatggccggtcatggtgag
gttgctgactggcaacaaaagcttgatggtgatgccttccgggccaaggcggccaaggtg
gctgccctggccgctacggcggaaccctcacgtattctggctggcccggcggtcggtgaa
tctgcctga

DBGET integrated database retrieval system