KEGG   Laribacter hongkongensis: LHK_02196Help
Entry
LHK_02196         CDS       T00884                                 

Gene name
tesA
Definition
TesA (EC:3.1.2.20)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lhk  Laribacter hongkongensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LHK_02196 (tesA)
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LHK_02196 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LHK_02196 (tesA)
Lipid biosynthesis proteins [BR:lhk01004]
 Fatty acid synthase
  Component type
   LHK_02196 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2084815..2085423
Genome map
AA seq 202 aa AA seqDB search
MRYVFWLLAGWTSLACVPALAATIMVFGDSLSAGYGLKAGEGWVSLLARELAPRHRVINA
SVSGETSAGGLTRLPAALQQHKPDVLILALGGNDGLRGLPPVELRDNLDRMVELARARRT
RVLLVGIELPPNYGPRYTREFAAVYDEVARNRKLPLVPSLIAGFGADRSMFQPDAIHPIA
AAQPRMLSVVKPALQPLLKDAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgttttctggctgttggccggttggaccagtctggcatgcgtgccggcactg
gcggcaaccatcatggtgttcggcgattcgctgtcggccggttatggcctgaaagcgggt
gaaggctgggtcagcctgctggcgcgcgagcttgctccccggcaccgggtcatcaacgcc
agtgtatcgggcgaaacctcggccggcgggctgacgcgtctgcccgctgcactgcaacag
cataaaccggatgtcctgatcctggcactgggtggcaacgacggcctgcgcgggttgccg
ccggtggagctgcgcgacaaccttgaccgcatggtggagctggcccgggcccgacggaca
cgggtgctgctggtgggcatcgagctgccgcccaactacggcccgcgctacacgcgcgaa
tttgccgctgtctatgatgaggtggcacgtaaccgcaagctgccgctggtgccttcgctg
attgcaggtttcggtgcggaccgcagcatgttccagccggatgccatccatccgatcgcc
gcggcccagccccgcatgctgtcggtagtgaaaccggccttgcagcctttactgaaagat
gcccgatga

DBGET integrated database retrieval system