KEGG   Laribacter hongkongensis: LHK_02269Help
Entry
LHK_02269         CDS       T00884                                 

Definition
(GenBank) Catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00020  Citrate cycle (TCA cycle)
lhk00620  Pyruvate metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
Module
lhk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_02269
   00020 Citrate cycle (TCA cycle)
    LHK_02269
   00620 Pyruvate metabolism
    LHK_02269
Enzymes [BR:lhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LHK_02269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACO75253
UniProt: C1DAD8
Position
complement(2150770..2151921)
Genome map
AA seq 383 aa AA seqDB search
MKTFCLPDLGEGLQEAEIVAWHVGEGSRVVLDQPLLSVETAKAIVDVPAPFAGLVMRCHA
GVGDIVPLGAPLVDIDEDAGCNDSGTVVGHVEPARPAAGAAASGVVFERKTAPDGGVVRA
MPAARLLAARLGVELSAVTGSGPDGVIVLADVEVQAGRQAPAPVAAPSVAEPPEHYERIR
GPRRAMAQSMSRAHADVAAVTLVEDADIDAWPAGSDTTLRLIRAIVAACRAVPVLNGWFD
AASLSFRRRDTIDLGVALDMDDALFVPVLRDVGARSEADLRAGIEAMKRDVKNRSLAPEE
LRGHSITLSNFGMVAGRYASPVIVPPTVCIVGAGRIRPQPVAVGESVGVHRVLPVSLTFD
HRAATGMEAARFLRVLVADLQAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttttgtctgcccgatctgggcgaaggcttgcaggaagcggaaatcgtggcc
tggcatgtcggcgagggcagccgggtggtgcttgaccagccgctcctgtcggtggaaacg
gccaaggcgattgtcgacgtaccggctccgtttgccgggctggtcatgcgttgtcatgcc
ggagtcggcgacatcgtgccgctgggcgcgccactggtggacattgacgaggacgcgggc
tgcaatgacagcggcacggtggtaggccatgtggaacccgcccgtccggcagccggtgcc
gccgcgtccggcgtggtgttcgagcggaaaacggcaccggacggaggcgtggtccgggcc
atgccggcggcccgcctgctggctgcccggctgggagtggagctgtctgcggtcacgggc
agcggcccggacggggtgatcgtgctggcggatgtcgaggtgcaggccggacggcaggct
ccggctccggtggcggcaccgtctgtggccgagccgcccgaacactacgagcgcatccgt
ggtccgcgccgcgccatggcccagtcgatgagccgggcccatgcggacgtggctgccgtg
acgctggttgaggatgccgacattgatgcctggcctgcgggcagcgacacgaccctgcgg
ctgatccgcgccatcgtggcagcctgccgcgccgtgccggtactcaacggctggtttgat
gctgccagcctgtcgttccggcgccgcgacacgatcgacctcggcgtggcgctggacatg
gatgacgcgctgttcgtgccggtgttgcgcgatgtgggcgcgcgcagcgaggcagacctg
cgtgcaggcatcgaagcgatgaagcgcgacgtaaaaaaccggtcgctggcgccggaagaa
ctgcgcggccacagcatcacgctatcgaatttcggcatggtggccgggcgttacgccagt
ccggtgatcgtgccgcccactgtctgcatcgtgggagccggccgcatccggccgcagccg
gtggccgtgggggaatcggtcggcgtccaccgtgtcctgccggtatcgctgacctttgac
caccgggctgccaccggcatggaggccgcgcgcttcctgcgcgtgctggtggccgacctg
caggccggctga

DBGET integrated database retrieval system