KEGG   Laribacter hongkongensis: LHK_02364Help
Entry
LHK_02364         CDS       T00884                                 

Definition
Response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lhk  Laribacter hongkongensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:lhk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:lhk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2256946..2257635)
Genome map
AA seq 229 aa AA seqDB search
MTARRDDPLVIAPCHAADVILPRSGSRTVGRPPLLAIGASTGGTEALKVVLGQLPRDCPP
VLVTQHMPPVFTRSFAARLDALCQIGVKEAEDGELLGNGMAYVAPGDAHLMVVWQGGRYR
CRLSQGVEVNRHRPSVDVLFRSVANEAGAAAMGVILTGMGRDGASGMRELKDTGAFTVAQ
DEGTCVVFGMPKEAIAQGGVEEVLPLERIGLRMVEWCRGRGPASDSRRI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcccggcgtgatgatccgctggtcattgctccgtgtcatgcggcggacgtgatc
ctgccccgttccggcagccggaccgtcggccgcccgcccctgctggcgattggcgcttcg
accggcgggaccgaggcattgaaagtcgtgctggggcaactcccgcgtgactgtccgccg
gtgctggtcacgcagcacatgccgccggtattcacccggtcgtttgcggcccggctggac
gccttgtgccagatcggtgtcaaggaagccgaggacggtgagctgctgggtaacggcatg
gcttacgtggcgccgggtgatgcacacctgatggtggtctggcagggcggacgttatcgc
tgccgcttgagccagggcgtggaagtcaaccggcaccggccttcggtggacgtgctgttc
cggtcggtggccaatgaggccggcgcagccgcgatgggcgtgatcctgaccggcatgggg
cgtgacggcgccagcggcatgcgcgaactgaaagatacgggcgcatttaccgtggcgcag
gacgagggcacttgcgtggtattcggcatgcccaaggaagcgattgcccaagggggagtt
gaagaagtcttgccgctggagcggatcgggctgcgcatggtggaatggtgccgcggtcgc
gggccggcttcggacagtcggagaatctga

DBGET integrated database retrieval system