KEGG   Laribacter hongkongensis: LHK_02383Help
Entry
LHK_02383         CDS       T00884                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lhk  Laribacter hongkongensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lhk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2271915..2273237)
Genome map
AA seq 440 aa AA seqDB search
MVVVIGAGISGLSCAWHLQQRGIPVVVLEAGSRVGGKIGTVAADGYRLELGPNTLYGHAG
HLDLLERLGLTAAIRPAAAVVRHRFVLRGDRYEALPSGPLSFLTGSQFGARSKWLALTEP
FRRNRPVREPETVAAFFRRRLGDEFVERAISPFVGGIFAGDPEELVAGLTLPVIHEAERQ
SGSIVRGMFARRKTFRRKATFTLNEGLQQLPETLAQGLDVRLDTSVQALERLETGWRVRT
PAGELDADEVVLAVPADVAGQLLASHFPAIAANLANVTYAPVAVLHTAWPRSTVGHDLDG
FGGLNPKVEKPFAAGSIWSGSLFPDRTPAGETLLTTFVGGMQFLDRYRHDDATLVALALE
ELRRLYRIQGEPTLCRLTRQEQAIPQYDSHALPLASAVSDLHEHGIRVCANWHGGVSVVD
CLDKGQQVAVQCLLDYPPAS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtgatcggtgccggcatttccggcctgtcgtgtgcctggcacctgcaacag
cggggcatccccgtcgtggtgctggaggccggcagccgggtcggcggcaagatcgggacg
gtagcggccgacggttaccggctggaactcggccccaataccctttacggccatgccggg
catctggaccttctggaacggctgggcctcacggcagccatccggccggcggcggccgtg
gtccggcaccgtttcgtgctgcgcggcgatcgctacgaggccctgccgtccggaccgctg
tcgttcctgaccggatcgcagttcggtgcccggagcaaatggctggcgctgaccgagcct
ttccggcgcaaccggccggtgcgtgagccggaaaccgtggctgcctttttccggcgtcgt
ctgggcgacgaatttgtcgagcgggccatttcgccgtttgtcggcggcatttttgccggt
gatcccgaagagctggtggccggactgacgctgccggtcatccacgaagccgagcgccag
tcaggctccatcgtgcgcggcatgtttgcccgccgcaaaaccttccggcgcaaggccacc
ttcaccctgaacgagggtttgcagcagctgcccgaaacgctggcgcaggggctggacgta
cggctggatacgtcggtgcaggcactggagcggctggaaaccggctggcgggtcagaacc
ccagcaggtgaactggacgccgacgaagtggtgctggccgtgccggccgacgtggccggg
caactgctggccagccattttccggccattgcagcgaaccttgccaacgtaacctacgcc
ccggtggccgtcctgcatacggcctggccacgcagcacggtcgggcatgacctcgacggt
tttggcgggctgaaccccaaagtcgaaaaaccgtttgccgccggctccatctggtccggc
tcgctgtttcccgaccgcacgccggcaggcgaaaccctgctgaccacctttgtcggcggc
atgcagttccttgaccgttaccggcacgatgacgccacgctggtggcgctggcgctggaa
gaactgcggcggctctaccgcatccagggcgagccgaccctttgccggctgacccgtcag
gagcaggccattccgcagtacgacagccatgccctgccgctggccagcgcggtcagtgac
ctgcatgaacacggtatccgcgtgtgtgccaactggcatggcggggtatcggtcgtcgac
tgtctcgacaaggggcagcaggtggctgtccagtgcttgctggactacccgccggccagc
tga

DBGET integrated database retrieval system