KEGG   Laribacter hongkongensis: LHK_02413Help
Entry
LHK_02413         CDS       T00884                                 

Gene name
lpdA2
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LHK_02413 (lpdA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_02413 (lpdA2)
   00020 Citrate cycle (TCA cycle)
    LHK_02413 (lpdA2)
   00620 Pyruvate metabolism
    LHK_02413 (lpdA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_02413 (lpdA2)
   00280 Valine, leucine and isoleucine degradation
    LHK_02413 (lpdA2)
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     LHK_02413 (lpdA2)
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LHK_02413 (lpdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302232..2303665)
Genome map
AA seq 477 aa AA seqDB search
MSQQFDVVVIGGGPGGYVAAIRAAQLGFNTACVDSFKNPEGQPSLGGTCLNVGCIPSKAL
LQSSENLHAVQHDFAAHGISVNGASMDVGTMLKRKEGIIGKNAAGIAFLFKKNKVANIHG
LATLKARQNEKWVIEVTDNGAVVDTLEATHVIIATGSRPRPLPGVAIDNRVVLDNAGALA
MTGVPQRLGVIGSGVIGLEMGSVWKRLGAEVTVLEAMPAFLAAADQQIAKEAFKYLTKQT
GLDIQLGVKIGDIKVADDSVSVAYEVGGEQKVAEFDRLIVSIGRVPNTDGLGAENVGLQV
DERGFVVVDDNCHANLPNVWAIGDVVRGPMLAHKASEEGVAVAERIAGQKPHIDFGMIPW
VIYTSPEIAWVGKTEEQLKAEGIEYKKGTSGFAANGRALGLGMAQGTVKVLACAKTDRIL
GVHIIGPFASELIAEAVVAMEFAASSEDIARIVHAHPSLSEVLHEACLAADKRALHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacaattcgacgtcgtcgtgatcggtggcggtcccggcggttatgtagctgcc
attcgtgctgcccagctgggtttcaataccgcttgcgtggacagtttcaaaaaccccgaa
ggccagccgagcctcgggggcacatgcctgaacgtcggctgcattccgtccaaggcgctg
ttgcagtcgagtgaaaacctccatgccgtgcagcatgactttgctgcccacggcatcagc
gtgaatggtgccagcatggatgtaggcacgatgctcaagcgcaaggaaggcatcatcggc
aagaacgccgccggcatcgccttcctgttcaagaaaaacaaggtggccaacatccacggc
ctggcaacgctcaaggcgcgccagaacgaaaaatgggtcattgaagtgaccgacaacggt
gccgtggtcgatacgctggaagccacccacgtcatcatcgccaccggttcccgtccgcgt
ccgctgccgggtgtcgccattgacaaccgcgtggtgctcgacaacgccggcgcgctggcc
atgaccggtgtaccgcagcgtctgggcgtcattggttccggcgtcatcggtctggaaatg
ggcagtgtgtggaagcggctgggagccgaggtcaccgtgctggaggccatgccggccttc
ctggctgctgccgaccagcagatcgccaaagaggcattcaagtacctgaccaagcagacc
gggctggacatccagctgggtgtgaagatcggtgacatcaaggtggctgacgacagcgtg
tcggtggcctatgaggtcggcggcgagcagaaagtggccgaattcgaccgcctgatcgtg
tcgatcggccgcgtgccgaacaccgacggtctgggtgccgaaaacgtcggactgcaagtt
gacgagcgtggttttgtggtggtggacgacaactgccatgccaacctgccgaacgtctgg
gccatcggtgacgtggtgcgtggcccgatgctggcgcacaaggccagcgaagaaggcgtg
gccgtggccgagcgcattgccggacaaaagccgcatatcgacttcggcatgatcccgtgg
gtgatctacaccagtccggaaatcgcctgggtcggcaagaccgaagagcagctcaaggcc
gaaggcatcgagtacaagaaaggcacgtcgggttttgccgccaacggccgggcgctggga
ctgggcatggcccaaggaaccgtcaaggtgctggcctgcgccaaaaccgaccgcattctc
ggggtgcacatcatcggcccgtttgcgtccgagctgattgccgaagccgtggtggcgatg
gagtttgccgcatcgagcgaagacattgcccgcatcgtgcatgcgcatccgtcgctgtcc
gaagtgctgcacgaagcctgtctggcggctgacaagcgcgccctgcacggctga

DBGET integrated database retrieval system