KEGG   Laribacter hongkongensis: LHK_02413Help
Entry
LHK_02413         CDS       T00884                                 

Gene name
lpdA2
Definition
(GenBank) LpdA2
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00010  Glycolysis / Gluconeogenesis
lhk00020  Citrate cycle (TCA cycle)
lhk00260  Glycine, serine and threonine metabolism
lhk00280  Valine, leucine and isoleucine degradation
lhk00620  Pyruvate metabolism
lhk00630  Glyoxylate and dicarboxylate metabolism
lhk00640  Propanoate metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01120  Microbial metabolism in diverse environments
lhk01130  Biosynthesis of antibiotics
lhk01200  Carbon metabolism
Module
lhk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lhk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lhk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LHK_02413 (lpdA2)
   00020 Citrate cycle (TCA cycle)
    LHK_02413 (lpdA2)
   00620 Pyruvate metabolism
    LHK_02413 (lpdA2)
   00630 Glyoxylate and dicarboxylate metabolism
    LHK_02413 (lpdA2)
   00640 Propanoate metabolism
    LHK_02413 (lpdA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_02413 (lpdA2)
   00280 Valine, leucine and isoleucine degradation
    LHK_02413 (lpdA2)
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     LHK_02413 (lpdA2)
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LHK_02413 (lpdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 Pyr_redox_3 GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8 HI0933_like 3HCDH_N FAD_binding_3 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: ACO75395
UniProt: C1DB56
Position
complement(2302232..2303665)
Genome map
AA seq 477 aa AA seqDB search
MSQQFDVVVIGGGPGGYVAAIRAAQLGFNTACVDSFKNPEGQPSLGGTCLNVGCIPSKAL
LQSSENLHAVQHDFAAHGISVNGASMDVGTMLKRKEGIIGKNAAGIAFLFKKNKVANIHG
LATLKARQNEKWVIEVTDNGAVVDTLEATHVIIATGSRPRPLPGVAIDNRVVLDNAGALA
MTGVPQRLGVIGSGVIGLEMGSVWKRLGAEVTVLEAMPAFLAAADQQIAKEAFKYLTKQT
GLDIQLGVKIGDIKVADDSVSVAYEVGGEQKVAEFDRLIVSIGRVPNTDGLGAENVGLQV
DERGFVVVDDNCHANLPNVWAIGDVVRGPMLAHKASEEGVAVAERIAGQKPHIDFGMIPW
VIYTSPEIAWVGKTEEQLKAEGIEYKKGTSGFAANGRALGLGMAQGTVKVLACAKTDRIL
GVHIIGPFASELIAEAVVAMEFAASSEDIARIVHAHPSLSEVLHEACLAADKRALHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacaattcgacgtcgtcgtgatcggtggcggtcccggcggttatgtagctgcc
attcgtgctgcccagctgggtttcaataccgcttgcgtggacagtttcaaaaaccccgaa
ggccagccgagcctcgggggcacatgcctgaacgtcggctgcattccgtccaaggcgctg
ttgcagtcgagtgaaaacctccatgccgtgcagcatgactttgctgcccacggcatcagc
gtgaatggtgccagcatggatgtaggcacgatgctcaagcgcaaggaaggcatcatcggc
aagaacgccgccggcatcgccttcctgttcaagaaaaacaaggtggccaacatccacggc
ctggcaacgctcaaggcgcgccagaacgaaaaatgggtcattgaagtgaccgacaacggt
gccgtggtcgatacgctggaagccacccacgtcatcatcgccaccggttcccgtccgcgt
ccgctgccgggtgtcgccattgacaaccgcgtggtgctcgacaacgccggcgcgctggcc
atgaccggtgtaccgcagcgtctgggcgtcattggttccggcgtcatcggtctggaaatg
ggcagtgtgtggaagcggctgggagccgaggtcaccgtgctggaggccatgccggccttc
ctggctgctgccgaccagcagatcgccaaagaggcattcaagtacctgaccaagcagacc
gggctggacatccagctgggtgtgaagatcggtgacatcaaggtggctgacgacagcgtg
tcggtggcctatgaggtcggcggcgagcagaaagtggccgaattcgaccgcctgatcgtg
tcgatcggccgcgtgccgaacaccgacggtctgggtgccgaaaacgtcggactgcaagtt
gacgagcgtggttttgtggtggtggacgacaactgccatgccaacctgccgaacgtctgg
gccatcggtgacgtggtgcgtggcccgatgctggcgcacaaggccagcgaagaaggcgtg
gccgtggccgagcgcattgccggacaaaagccgcatatcgacttcggcatgatcccgtgg
gtgatctacaccagtccggaaatcgcctgggtcggcaagaccgaagagcagctcaaggcc
gaaggcatcgagtacaagaaaggcacgtcgggttttgccgccaacggccgggcgctggga
ctgggcatggcccaaggaaccgtcaaggtgctggcctgcgccaaaaccgaccgcattctc
ggggtgcacatcatcggcccgtttgcgtccgagctgattgccgaagccgtggtggcgatg
gagtttgccgcatcgagcgaagacattgcccgcatcgtgcatgcgcatccgtcgctgtcc
gaagtgctgcacgaagcctgtctggcggctgacaagcgcgccctgcacggctga

DBGET integrated database retrieval system