KEGG   Laribacter hongkongensis: LHK_02413Help
Entry
LHK_02413         CDS       T00884                                 

Gene name
lpdA2
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lhk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lhk00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lhk00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lhk00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lhk00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:lhk00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302232..2303665)
Genome map
AA seq 477 aa AA seqDB search
MSQQFDVVVIGGGPGGYVAAIRAAQLGFNTACVDSFKNPEGQPSLGGTCLNVGCIPSKAL
LQSSENLHAVQHDFAAHGISVNGASMDVGTMLKRKEGIIGKNAAGIAFLFKKNKVANIHG
LATLKARQNEKWVIEVTDNGAVVDTLEATHVIIATGSRPRPLPGVAIDNRVVLDNAGALA
MTGVPQRLGVIGSGVIGLEMGSVWKRLGAEVTVLEAMPAFLAAADQQIAKEAFKYLTKQT
GLDIQLGVKIGDIKVADDSVSVAYEVGGEQKVAEFDRLIVSIGRVPNTDGLGAENVGLQV
DERGFVVVDDNCHANLPNVWAIGDVVRGPMLAHKASEEGVAVAERIAGQKPHIDFGMIPW
VIYTSPEIAWVGKTEEQLKAEGIEYKKGTSGFAANGRALGLGMAQGTVKVLACAKTDRIL
GVHIIGPFASELIAEAVVAMEFAASSEDIARIVHAHPSLSEVLHEACLAADKRALHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacaattcgacgtcgtcgtgatcggtggcggtcccggcggttatgtagctgcc
attcgtgctgcccagctgggtttcaataccgcttgcgtggacagtttcaaaaaccccgaa
ggccagccgagcctcgggggcacatgcctgaacgtcggctgcattccgtccaaggcgctg
ttgcagtcgagtgaaaacctccatgccgtgcagcatgactttgctgcccacggcatcagc
gtgaatggtgccagcatggatgtaggcacgatgctcaagcgcaaggaaggcatcatcggc
aagaacgccgccggcatcgccttcctgttcaagaaaaacaaggtggccaacatccacggc
ctggcaacgctcaaggcgcgccagaacgaaaaatgggtcattgaagtgaccgacaacggt
gccgtggtcgatacgctggaagccacccacgtcatcatcgccaccggttcccgtccgcgt
ccgctgccgggtgtcgccattgacaaccgcgtggtgctcgacaacgccggcgcgctggcc
atgaccggtgtaccgcagcgtctgggcgtcattggttccggcgtcatcggtctggaaatg
ggcagtgtgtggaagcggctgggagccgaggtcaccgtgctggaggccatgccggccttc
ctggctgctgccgaccagcagatcgccaaagaggcattcaagtacctgaccaagcagacc
gggctggacatccagctgggtgtgaagatcggtgacatcaaggtggctgacgacagcgtg
tcggtggcctatgaggtcggcggcgagcagaaagtggccgaattcgaccgcctgatcgtg
tcgatcggccgcgtgccgaacaccgacggtctgggtgccgaaaacgtcggactgcaagtt
gacgagcgtggttttgtggtggtggacgacaactgccatgccaacctgccgaacgtctgg
gccatcggtgacgtggtgcgtggcccgatgctggcgcacaaggccagcgaagaaggcgtg
gccgtggccgagcgcattgccggacaaaagccgcatatcgacttcggcatgatcccgtgg
gtgatctacaccagtccggaaatcgcctgggtcggcaagaccgaagagcagctcaaggcc
gaaggcatcgagtacaagaaaggcacgtcgggttttgccgccaacggccgggcgctggga
ctgggcatggcccaaggaaccgtcaaggtgctggcctgcgccaaaaccgaccgcattctc
ggggtgcacatcatcggcccgtttgcgtccgagctgattgccgaagccgtggtggcgatg
gagtttgccgcatcgagcgaagacattgcccgcatcgtgcatgcgcatccgtcgctgtcc
gaagtgctgcacgaagcctgtctggcggctgacaagcgcgccctgcacggctga

DBGET integrated database retrieval system