KEGG   Laribacter hongkongensis: LHK_02546Help
Entry
LHK_02546         CDS       T00884                                 

Definition
(GenBank) Pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LHK_02546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHK_02546
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LHK_02546
Enzymes [BR:lhk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LHK_02546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2426572..2427921)
Genome map
AA seq 449 aa AA seqDB search
MNQTKFLLPESEIPTHWYNVVADMPNKPAPVLGPDGQPISPDALSAIFVDSLIEQEVSTE
RWIPIPEPVREIYRLWRPAPLFRAHRLEAELGTPARIYYKYEGVSPAGSHKLNSAIAQAY
YNREAGIRRMTTETGAGQWGCSLALAGQMFGIDIRVFMVKVSYQQKPFRRSMMQTWGAEV
LASPSPLTAAGRAALEADDNNPGSLGLAIAEAVEEAASRSDTTYGLGSVLNHVLLHQTVI
GLEAKKQFELAGDYPDMIFAPCGGGSNFGGVAFPFFADKAAGRNVRLVAVEPASCPSLTR
GHYSYDYGDTAGLTPLMKQYTLGHDFMPPSIHAGGLRYHGASTLVSQLVHEGLVEAVAVP
QLATFEAGVTFARTEGIVPAPESCHGIRAVIDEARRCTESGESKALFFNLSGHGHFDMAS
YDKYLAGDLEDYVYPEEAIRAALARLPRV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccaaattcctgttgcccgaatccgagatcccgacccactggtacaacgtg
gtggcggacatgcccaacaagcccgcaccggtactcggacccgatggccagccgatttct
cccgacgccttgtcggccatcttcgtcgacagcctgatcgaacaggaagtctcgacggag
cgctggattccgattccggaaccggtgcgggaaatctaccggctctggcggccggctcct
ctgttccgggcccaccggctcgaagccgaactgggtactcctgcgcggatctactacaag
tacgaaggcgtcagtccggccggcagccacaagctcaattcggccattgcccaggcgtac
tacaaccgtgaagccggtatccgccgcatgacgaccgaaaccggtgccggccagtggggt
tgttcgctggcgctggccggccagatgttcggcatcgacatccgggtgttcatggtgaag
gtgagttaccagcaaaagcctttccgccgctccatgatgcagacttggggggccgaggtt
ctggccagtccgtcgccgctgacggcagccggccgggctgcgctggaggccgacgacaat
aatccaggttcgctgggactggcgatcgccgaggcggtggaagaagcggccagccgcagc
gacacgacgtatggcctggggtcggtgctcaaccacgtgctgctgcaccagaccgtgatc
ggtctggaggcgaaaaagcagttcgagctggctggtgattatcccgacatgatttttgcg
ccgtgcggcggcggctccaacttcggcggcgtggcatttccgttctttgccgacaaggcg
gccgggcgcaacgtgcggctggtggctgtggagccggcatcgtgtccgagcctgacccgc
gggcattattcctacgactatggcgatactgcaggcctgacgccgctgatgaagcagtac
acgctcggacacgacttcatgccgccgtccattcatgccggaggtttgcgctatcacggc
gcctcgacgctggtcagccagctggtgcacgaaggactggtcgaggcagttgccgtgccg
cagctggcaacgttcgaggccggggtgacgtttgcccggaccgagggcatcgtgccggca
ccggaaagctgccacggtatccgtgccgtcatcgacgaggcccggcgctgtaccgaaagc
ggcgagtccaaagcgctgttcttcaacctgtccggccatgggcatttcgacatggccagc
tacgacaagtatctggcgggcgatctggaagactatgtctatccggaagaggccatccgt
gcggcactggcgcgtttgccgcgagtgtga

DBGET integrated database retrieval system