KEGG   Laribacter hongkongensis: LHK_02666Help
Entry
LHK_02666         CDS       T00884                                 

Gene name
cpx
Definition
Cpx (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lhk  Laribacter hongkongensis
Brite
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LHK_02666 (cpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2539735..2540793
Genome map
AA seq 352 aa AA seqDB search
MNRQIALGMAAATLALPLLAVAADNATLTTARAVFAPLPASADNHATNKLNPAKVALGKQ
LYFDARLSKGGTVSCNTCHNLATYGVDNLPTSMGHKGMFGGRNAPTVMNAALLKPHFWDG
RAKDAEEQAKGPIMNPVEMAIPHEGFAVERIASIPEYQAQFQKAFPGEKAPLTYDNIANA
IAAFERTLLTPSRFDAWLKGDAKAMSAQEVRGVKTFVEKGCVACHAGSTIGGDNFFKFGL
VKGPYSDFTGVKNTDHGVYDLTKKDSDMDVFRTPTLRNVERTYPYFHDGSVWELDKAVRI
MGQTQLGIQLNDQEVADITAFLKSLTGTVPTAALQLPILPASTAKTTKPDNM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcaaattgctctgggaatggccgctgcaacgcttgccctgccgctgctggca
gtcgccgccgacaatgcgaccctcacaactgcccgcgccgtgtttgcacccctgcccgcc
tcggcagacaaccacgccaccaacaagctcaatccggccaaggtggcacttggcaaacaa
ctgtatttcgacgcacgtctttcgaaggggggtacggtcagctgtaacacctgtcacaac
ctggccacctatggtgtcgacaacctgccgacctcgatggggcacaagggcatgttcggt
ggccgtaacgccccgaccgtgatgaacgccgccctgctcaagccgcacttctgggacggc
cgcgccaaggatgccgaagaacaggccaagggtccgatcatgaacccggtggaaatggct
attccgcacgaaggctttgccgtcgagcgcatcgcctcgatcccggaataccaggcccag
ttccagaaggccttcccgggtgaaaaggctccgctgacctacgacaacatcgccaacgcc
attgccgctttcgagcgcaccttgctgaccccgtcgcgctttgacgcctggctcaagggt
gacgccaaggccatgagcgcccaggaagtccgcggtgtgaagacctttgtcgagaagggc
tgtgtagcctgtcacgccggcagcaccatcggcggcgacaacttcttcaagttcggtctg
gtcaagggtccgtacagcgacttcaccggcgtcaagaataccgaccacggtgtctacgac
ctgaccaagaaggattcggacatggacgtgttccgtacgccgaccctgcgcaacgtcgaa
cgcacctacccgtacttccacgacggcagcgtgtgggaactcgacaaggccgtgcgcatc
atgggccagacccagctcggcatccagctcaacgaccaggaagtggccgacatcaccgct
ttcctgaagtcgctgaccggcaccgtgccgactgccgccctgcaactgccaatcctgccg
gcctcgaccgccaagaccaccaagccggacaacatgtaa

DBGET integrated database retrieval system