KEGG   Laribacter hongkongensis: LHK_02742Help
Entry
LHK_02742         CDS       T00884                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lhk  Laribacter hongkongensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LHK_02742
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LHK_02742
Enzymes [BR:lhk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     LHK_02742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2620717..2622027
Genome map
AA seq 436 aa AA seqDB search
MSTREQQIAALEKDWAENPRWKNVKRGYSAADVVRLRGSLQPEYTLARRGAEKLWDKVNG
GAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPT
MVRRINNTFKRADEIQWSRGINPGDAEFVDYFLPIVADAEAGFGGVLNAFELMKNMIAAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIEKLISARFAADVMGVPTLILARTDAEAAN
LLTSDHDANDKPFCTGERTQEGFYRVKNGLEQAISRGVAYAPYADLVWCETGTPDLGFAR
EFAQAVLAANPGKLLSYNCSPSFNWKKNLDDKTIASFQDELSALGYKYQFITLAGIHINW
YNTFQFAHAYARGEGMKHYTEMVQQPEFAAREQGYTFVSHQQEVGAGYFDDVTTVIQGGS
SSVKALTGSTEEEQFH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcgcgaacaacaaatcgccgccctggaaaaagactgggctgaaaacccccgc
tggaaaaacgtcaagcgcggttactcggctgctgacgtggtgcgtctgcgcggctcgctg
cagccggaatacaccctggcccgccgcggtgcggaaaagctgtgggacaaggtcaacggc
ggtgccaagaagggttacgtgaacgctttcggcgccatcaccgccggtcaggccatgcag
caggccaaggcaggtctggaagccgtgtacctctccggctggcaggtcgccgccgacggc
aacacctccgaaaccatgtacccggaccagtcgctgtacgcctacgactcggtgccgacc
atggtgcgccgcatcaacaacaccttcaagcgtgctgacgaaatccagtggagccgtggc
atcaacccgggcgacgccgagttcgtcgactacttcctgccgatcgtggctgacgccgaa
gccggcttcggtggcgtgctcaacgccttcgaactgatgaagaacatgattgccgccggc
gcggcaggcgtgcacttcgaagaccagctggctgccgtgaagaagtgcggccacatgggc
ggcaaggtgctggttccgacccaggaagccatcgagaagctgatctcggcccgttttgcc
gccgacgtcatgggcgtgccgaccctgatccttgcccgtaccgatgccgaagcggccaac
ctgctgacctcggaccacgacgccaacgacaagccgttctgcaccggcgaacgtacacag
gaaggcttctaccgcgtcaagaacggtctggaacaagccatcagccgcggcgttgcctac
gcaccgtacgctgacctcgtctggtgcgaaaccggcaccccggacctcgggttcgcccgc
gaattcgcccaggccgtgctggctgccaacccgggcaagctgctgtcgtacaactgctcg
ccgtccttcaactggaagaagaacctcgacgacaagaccatcgcctccttccaggacgaa
ctctcggcactgggctacaagtaccagttcatcaccctggccggcatccacatcaactgg
tacaacaccttccagttcgcccacgcttacgcccgcggcgaaggcatgaagcactacacc
gaaatggtgcagcagccggaatttgctgcccgcgaacagggttataccttcgtgtcgcac
cagcaggaagtcggcgccggctacttcgacgacgtcaccaccgtgatccagggcggttcc
tcgtcggtgaaggccctgaccggttcgaccgaagaagaacagttccactga

DBGET integrated database retrieval system