KEGG   Laribacter hongkongensis: LHK_02876Help
Entry
LHK_02876         CDS       T00884                                 

Gene name
galU
Definition
GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lhk  Laribacter hongkongensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LHK_02876 (galU)
   00052 Galactose metabolism
    LHK_02876 (galU)
   00500 Starch and sucrose metabolism
    LHK_02876 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LHK_02876 (galU)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LHK_02876 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2777357..2778226)
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGITELVFVTGRS
KRAIEDHFDKAYELETELELRNKHRLLDTVRGILPRNVSCLYTRQTEALGLGHAVLCARP
AVGDEPFAVILADDLVDSPSGAVAELVGHYQTVGASVLGVERVDPRDTGSYGIVEVVPAE
GSQRVTSIVEKPHPDVAPSNLAVIGRYILTPAIFDKLRTVTPGAGGEIQLTDGIAMLMQD
EAVFAKPLSGVRYDCGSKLGYLKATVDFALRHPEVGRGFADWLESRHAG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgattcgcaaggccgtgtttccggtggccggaatgggcacccgctttttgccg
gccaccaaggccagccccaaggaaatgctgccggtcgtggacaagccgctgatccagtat
gccgttgaggaggccgtggctgccggcattaccgaactggtgttcgtcaccggccgcagc
aagcgggccatcgaggaccacttcgacaaggcctacgaactggaaaccgaactggagctg
cgcaacaagcaccggctgctggataccgtgcggggcatcctgccgcgcaacgtgtcgtgc
ctctacacccgccagaccgaggcgctggggcttggtcatgccgtgctgtgcgcccggccg
gccgtgggcgacgagccgtttgccgtgatcctggccgacgacctagtggattcgccctcc
ggcgcggtggccgagctggtcggacattaccagaccgtcggtgcatcggtgctgggtgtg
gaacgggtagacccgcgcgataccggttcgtacggcattgtcgaggtggtgccggccgaa
ggcagccagcgggtcaccagcatcgtggaaaaaccgcatccggacgtggcgccttcaaac
ctggcggtgatcgggcgctatatcctgacaccggcgatttttgacaagctgcgtaccgtg
acgccaggtgccggcggggaaatccagctgaccgacggcattgccatgctgatgcaggac
gaagccgtgtttgccaaaccgctgtcgggcgtgcgctatgactgcggctccaagctgggt
tacctgaaagcgacggtcgactttgcccttcgtcaccccgaggtcggccgcggctttgcc
gactggctagaatcgcgccacgccgggtag

DBGET integrated database retrieval system