KEGG   Laribacter hongkongensis: LHK_02899Help
Entry
LHK_02899         CDS       T00884                                 

Gene name
folP
Definition
FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lhk  Laribacter hongkongensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lhk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800995..2801837)
Genome map
AA seq 280 aa AA seqDB search
MTHLACGRYRLSLDRPLVMGILNVTPDSFSDGGRFQGRDAALAQADRLMAEGADLLDIGG
ESTRPNAPVVSASEETDRVLPVLEALQGCGVPLSLDTRKTAVMQAGLALGVDLINDIAAL
EDDGALALLAACPAAICLMHKQGDPATMQQQPRYARVQDEVHAYLSARVAACLAAGIAAE
RLLVDPGFGFGKTVMHNYQLLDDLPRLGTLAPVLVGMSRKSMLGAVTGVTEPAARTVSSV
VAAVLAAERGAAVVRVHDVAATREGLAVWQALKDAGLARN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccttgcttgcggccgttaccggctttcccttgaccgaccattggtcatgggc
atcctgaatgtcacaccggattccttttcggatggcggcaggtttcaggggcgtgacgcc
gcgctggcgcaggcggaccggctgatggccgaaggtgccgacctgctggacatcggcggt
gaatcgacccgcccgaatgcaccggtcgtgagtgccagcgaagaaaccgaccgggtgctg
ccggtgctggaagccttgcagggatgcggtgtgccgctgtcgcttgatacccggaaaacg
gcagtgatgcaggccgggctggcgctgggagtggacctgatcaatgatatcgccgcgctg
gaagacgacggcgcgctggccctgctggcggcttgcccagccgccatctgcctgatgcac
aagcagggggatccggccaccatgcaacagcaaccaaggtatgcccgggtgcaggacgag
gttcatgcctatctgtcggctcgcgttgctgcctgtcttgccgccggcatcgccgcggaa
cgcctgctggtcgatcccggctttggctttggcaagaccgtgatgcacaactaccagctg
ctggacgatctgcctcgccttggcacgctggcgccagtgctggtcggcatgtcgcgcaag
tccatgctgggggcggtgaccggagtgaccgagcctgccgcccggacggtatcaagcgtt
gtggccgccgtgctggctgccgagcgtggtgctgccgtggtgcgtgtgcatgatgtggcc
gcaactcgtgagggtttggccgtctggcaggcgctgaaggatgccggcctcgcccgcaac
tga

DBGET integrated database retrieval system