KEGG   Laribacter hongkongensis: LHK_02994Help
Entry
LHK_02994         CDS       T00884                                 

Gene name
rfbC
Definition
(GenBank) RfbC
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00521  Streptomycin biosynthesis
lhk00523  Polyketide sugar unit biosynthesis
lhk01130  Biosynthesis of antibiotics
Module
lhk_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LHK_02994 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LHK_02994 (rfbC)
Enzymes [BR:lhk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LHK_02994 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACO75972
UniProt: C1D5F5
Position
complement(2908642..2909190)
Genome map
AA seq 182 aa AA seqDB search
MKVIDTAIAEVKIIEPRVFEDERGFFFESFNQQRFEEAIGYPVEFVQDNHSRSSRGVLRG
LHYQQAPHAQGKLVRCVAGAVWDVAVDLRQSSPTFGQSVGVELSAGNRRQLWIPAGFAHG
FLTLSESAEFLYKTTDYYAPAAEVCLRWNDPVLAIAWPEAVSPVLSVKDGQGLDWHQAPR
FA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcatcgatacggcgattgccgaagtcaagatcatcgagccgcgcgtgttcgag
gatgagcggggtttctttttcgagagcttcaaccagcagcgttttgaagaagccattggc
tacccggtggagttcgtgcaggacaatcacagccgttcatcacgcggcgtgttgcgcgga
ctgcattaccagcaggcaccgcatgcccagggcaagctggtgcgctgtgtggctggcgcg
gtgtgggacgtggccgttgatctgcggcaaagctcaccgacattcggccagtcggtcggt
gtggagttgtctgccggcaaccggcggcaactgtggattccggccgggtttgcccacggc
ttcctgaccttgagcgagtcggccgaattcctctacaagaccacggattattacgcgccg
gcagcagaagtgtgcctgcgctggaatgaccccgtactggcgattgcatggccggaggcg
gtcagtccggtgctgtccgtgaaggacgggcagggtctggactggcatcaggcgcccagg
tttgcctga

DBGET integrated database retrieval system