KEGG   Laribacter hongkongensis: LHK_03100Help
Entry
LHK_03100         CDS       T00884                                 

Gene name
glpK2
Definition
GlpK2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lhk  Laribacter hongkongensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LHK_03100 (glpK2)
Enzymes [BR:lhk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LHK_03100 (glpK2)
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LHK_03100 (glpK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3010741..3012219)
Genome map
AA seq 492 aa AA seqDB search
MSGFLLAIDQGTTSSRAMVFDRHSRVVARASRELEQFFPAPGWVEHDPDALWRDVEAVTR
EALAALPDGAAIAAIGLTNQRETTLLWNRRTGRPLHRAIVWQDRRTAPLCEQLAGQAAMV
QARTGLLLDPYFSATKLRWLLDTVPGAQEAACRGELAFGTVDSWLLWQLTEGRVHATDAT
NAARTLLFNIHTQTWDDELLALFDIPRSLLPEVRDSAADFGETRLFGAPLPIRGVAGDQQ
AAMIGQACFAPGMVKSTYGTGCFMVMNTGSVPLVSRHRLLTTVAYRLDGRPTYALEGSIF
IAGAAVQWLRDALRLIAHAGQTEALARELDSNDGVYLVPAFTGLGVPYWDPLARGTITGL
SRDTGINHIVRAALESVCYQSRDLLDAMRADGVAPASLRVDGGMAANDWLMQFLADMLAL
PVERPALTETTALGAAWLAGLGCGWYAGLDELAVQWHRQADFAPQMAADRRDGLYAGWRA
AVERTLSGGVSG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatttttgttggcgattgatcagggaaccaccagttcgcgtgccatggtgttc
gaccggcacagccgggtggtggcccgggccagccgtgagctggagcagttttttccggcg
ccgggctgggtcgaacacgacccggatgccctgtggcgcgatgtcgaggcggtgacgcgc
gaagcgctggcggccttgccggacggtgcggccattgccgccatcggcctgaccaaccag
cgggaaaccaccctgctgtggaaccgccgtaccgggcggccgctgcatcgcgccatcgtc
tggcaggaccggcgtaccgcaccgctgtgcgagcagctggccggacaggctgccatggtc
caggcacgtaccggcctgctgctcgatccgtatttttccgccaccaagctgcgctggctg
ctggataccgtgcccggtgcccaagaggcggcctgccggggcgaactggccttcggcacc
gtcgacagctggttgctgtggcagctgaccgaaggacgggtacacgcaaccgacgccact
aatgccgcccggacgctgctgttcaacatccacacccagacgtgggacgacgagctgctg
gcgctgttcgacatcccgcgctcgctgttgcccgaggtacgcgattcggcggccgatttt
ggcgaaacccggctgttcggggcgccgctgccgatccgtggcgtggctggtgaccagcag
gcggccatgatcggccaggcctgctttgcgccggggatggtcaagtccacctacggtacc
ggctgcttcatggtgatgaacaccggcagcgtgccgctggtatcacgccaccggctgctg
accacggtggcctaccggctggacggccggcccacctacgcgctggagggcagcattttc
atcgccggcgcagccgtgcagtggctgcgcgatgccttgcggctgatcgcccacgccggg
cagaccgaggcgctggcccgcgagctggattccaacgacggcgtctatctggtgccggcc
tttaccgggctgggcgtcccctactgggacccgctggcgcgcggcaccatcaccggcctg
tcacgcgataccggcatcaaccacatcgtgcgggcggcactggagtccgtgtgttaccag
agccgcgacctgctcgatgccatgcgcgccgatggcgtggcaccggcctcgctgcgggtc
gacggcggcatggcggccaacgactggctgatgcagttcctcgccgacatgctggcattg
ccggtggaacggccggcgctgaccgaaaccacggcactgggcgctgcctggctggcgggc
ctgggatgcggctggtatgccggactggacgaactggccgtgcagtggcaccggcaggcg
gactttgcaccgcagatggcagccgaccggcgggacgggctgtacgccggctggcgagca
gcggtggagcgtaccctgagcggtggcgtgtccggctga

DBGET integrated database retrieval system