KEGG   Lactobacillus helveticus H10: LBHH_0190Help
Entry
LBHH_0190         CDS       T01959                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lhl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lhl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lhl00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lhl00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lhl00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199011..199739
Genome map
AA seq 242 aa AA seqDB search
MDETLNFKRRYFMSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGL
EFDQAYTSLLTRAIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGLNKKKTAEKYGAE
QVHIWRRSYDVLPPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLERVMPFWEDHIA
PDLLDGKNVIIAAHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDENLDVVNKEKL
DD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacattgaattttaaaaggagatatttcatgtcaaaattagttttaatccgt
cacggacaaagtgaatggaacctttcaaaccaatttactggttgggttgatgttaacctt
tcagaaaaaggtgttgaagaagctaagaaggctggtcgtttaattaaggaacacggtctt
gaatttgatcaagcttacacttcattattaactcgtgccatcaagactttgcacttcgca
ttggaagaaagtggtcaactctggattccagaaatgaagacttggagacttaacgaacgt
cactacggtgctcttcaaggtttgaacaagaagaagactgctgaaaagtacggcgctgaa
caagttcacatttggcgtcgttcatacgatgtattgccaccagctattgatgatgacaat
gaattcagtcaagcacatgaccgtcgttacgcaaacttggacccacacatcgttcctaag
gcagaaaacttacacgtatgtcttgaacgtgtaatgccattctgggaagatcacattgct
ccagacttacttgacggcaagaacgtaattatcgcagctcacggtaactcacttcgtgct
ttgactaagtacatcgaaaacatttctgacgacgacattatgaacctcgaaatgaagact
ggtgaaccagttgtttacacattcgacgaaaacttggatgttgttaacaaggaaaagttg
gacgactaa

DBGET integrated database retrieval system