KEGG   Lactobacillus helveticus H10: LBHH_0190Help
Entry
LBHH_0190         CDS       T01959                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00010  Glycolysis / Gluconeogenesis
lhl00260  Glycine, serine and threonine metabolism
lhl00680  Methane metabolism
lhl01100  Metabolic pathways
lhl01110  Biosynthesis of secondary metabolites
lhl01120  Microbial metabolism in diverse environments
lhl01130  Biosynthesis of antibiotics
lhl01200  Carbon metabolism
lhl01230  Biosynthesis of amino acids
Module
lhl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_0190 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LBHH_0190 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBHH_0190 (gpmA)
Enzymes [BR:lhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBHH_0190 (gpmA)
Membrane trafficking [BR:lhl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBHH_0190 (gpmA)
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBHH_0190 (gpmA)
  Exosomal proteins of melanoma cells
   LBHH_0190 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADX69426
UniProt: F0NUC9
Position
199011..199739
Genome map
AA seq 242 aa AA seqDB search
MDETLNFKRRYFMSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGL
EFDQAYTSLLTRAIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGLNKKKTAEKYGAE
QVHIWRRSYDVLPPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLERVMPFWEDHIA
PDLLDGKNVIIAAHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDENLDVVNKEKL
DD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacattgaattttaaaaggagatatttcatgtcaaaattagttttaatccgt
cacggacaaagtgaatggaacctttcaaaccaatttactggttgggttgatgttaacctt
tcagaaaaaggtgttgaagaagctaagaaggctggtcgtttaattaaggaacacggtctt
gaatttgatcaagcttacacttcattattaactcgtgccatcaagactttgcacttcgca
ttggaagaaagtggtcaactctggattccagaaatgaagacttggagacttaacgaacgt
cactacggtgctcttcaaggtttgaacaagaagaagactgctgaaaagtacggcgctgaa
caagttcacatttggcgtcgttcatacgatgtattgccaccagctattgatgatgacaat
gaattcagtcaagcacatgaccgtcgttacgcaaacttggacccacacatcgttcctaag
gcagaaaacttacacgtatgtcttgaacgtgtaatgccattctgggaagatcacattgct
ccagacttacttgacggcaagaacgtaattatcgcagctcacggtaactcacttcgtgct
ttgactaagtacatcgaaaacatttctgacgacgacattatgaacctcgaaatgaagact
ggtgaaccagttgtttacacattcgacgaaaacttggatgttgttaacaaggaaaagttg
gacgactaa

DBGET integrated database retrieval system