KEGG   Lactobacillus helveticus H10: LBHH_0318Help
Entry
LBHH_0318         CDS       T01959                                 

Definition
Phosphoglycerate mutase 1 family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBHH_0318
   01230 Biosynthesis of amino acids
    LBHH_0318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_0318
  Energy metabolism
   00680 Methane metabolism
    LBHH_0318
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBHH_0318
Enzymes [BR:lhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBHH_0318
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBHH_0318
  Exosomal proteins of melanoma cells
   LBHH_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329474..330154
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEQQAKKAGELINTISDFAPTHIHTSVLS
RAIVTANIVAETCNLLWLPMTKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRSFDS
VPPKQGSPVIARRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINNHDIVNLEVPNAEPIVYTMDEQLNIVKKEILRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattggttcgacacggtgaaagtgttgctaatgccgcaaatgtttat
acgggctggaatgatgtgccgttaaccaaaaaaggtgagcaacaagctaaaaaagcaggt
gaattgattaatactatttctgattttgcaccaacgcatattcatacttctgttttgtcg
cgtgctattgtaacagccaatatcgtagctgagacgtgcaatctcttatggctacctatg
actaagacgtggcgtttaaatgaacggcattatggcgccttaagaggccttaacaaggat
atctcacgtaaagtctttggcgtagagcaagttttattatggcggcgcagttttgactct
gttccgccaaagcaaggctcgccagttatcgctcgacgttataagttgtgtgatcaacat
ttaatgccgcgtgcggagagtttgcatcaaacacaaaagcgactaatgccatattattat
gatcacattgcttcaagattgcttaatggtgaggatcaattaatagtagctcatggttca
agtttgcgagctttaattaaaaaattagaaaatattaacaatcacgatattgtaaacttg
gaagtgcctaacgcagaaccaattgtttatactatggatgagcagttaaatattgttaaa
aaagaaatactgaggagttaa

DBGET integrated database retrieval system