KEGG   Lactobacillus helveticus H10: LBHH_0330Help
Entry
LBHH_0330         CDS       T01959                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lhl00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344078..345577
Genome map
AA seq 499 aa AA seqDB search
MAKEKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVKGGSKSQ
MENLHWLGIDWDEGPDKGGDYGPYRQSERKEIYQKYIDQLIDEGKAYYSYKTEEELEAQR
EEQRAMGVAPHYTYEYEGMTADEIKQAQDEAKAKGLKPVVRIHIPEMETYSWDDIVKGHL
EFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMKITHVLRGDDHVSNTPKQLVVYEALGW
EPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPEAMFNFITLLGWSPKGENE
IFNKREFIKQFDPARLSKSPAAFDQKKLEWINNQYIKKADRDTLLDLALNNLQEAGLVDE
HPTPEKMEWIRQLVNIYSVQMSYTKQIVDMAKIFFEEAKDLSDEEIEEIKNDDGRGVIEE
FKKQLDLIPRFTSVQIMNAIQATRKATGVKGRKLFMPIRIATTRSMVGPGIGEAMELLGK
KRVVEHIDLTLKQMSENNL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagaaaaaatccgtgtaagatatgcaccaagtccaactggtcacttgcacatt
ggtaacgcacgtactgcactttttaactatttattcgcccgtcacaacaagggtactatg
gtattgagaattgaagataccgaccaaaaacgtaacgttaagggtggttccaagtctcag
atggaaaaccttcactggttgggtattgactgggatgaaggtccagataagggcggagac
tacggtccataccgtcaatcagaaagaaaagaaatttaccaaaagtatattgatcaattg
atcgatgaaggtaaggcatactactcatacaagactgaagaagaacttgaagcacaacgt
gaagaacaacgtgctatgggtgttgcacctcactatacttatgaatatgaaggcatgact
gctgatgaaatcaagcaagctcaagatgaagctaaggctaaaggcttgaagccagttgtt
cgtattcatattccagaaatggaaacctactcatgggatgatatcgttaagggtcacctt
gaattcgaatcagacaccatcggtggcgacttcgttattcaaaagcgtgatggtatgcca
acttacaactttgccgttgtaattgatgaccacttgatgaagatcactcacgtacttcgt
ggtgatgaccacgtttcaaacacacctaagcaattagttgtttatgaagcacttggttgg
gaaccacctaagtttggtcacatgactttgattatcaactcagaaactggtaagaagctt
tctaagcgtgatgaatcagttcttcaatttattgaacaatatcgtgaccttggttacttg
ccagaagctatgtttaacttcattactcttcttggttggtcaccaaagggtgaaaacgaa
atctttaacaagcgtgaattcatcaagcaatttgatccagctcgtttatctaagtcacct
gctgcatttgaccaaaagaagcttgaatggattaacaaccaatacatcaagaaggccgac
cgtgataccttgcttgaccttgctttgaacaacttgcaagaagcaggcttagttgatgaa
cacccaactccagaaaagatggaatggattcgtcaattggttaacatttactcagtacaa
atgtcatacactaagcaaatcgttgacatggctaagatcttctttgaagaagcaaaagat
ctttcagatgaagaaatcgaagaaatcaaaaacgatgatggtcgtggcgtaattgaagaa
ttcaagaagcaattagaccttattccaagatttacttcagttcaaatcatgaatgctatt
caagctactcgtaaagcaactggtgttaagggcagaaagctctttatgccaatcagaatt
gctactactcgttcaatggtgggccctggtattggtgaagctatggaacttttaggcaag
aagcgtgtggttgaacacattgatttgaccttaaagcaaatgagcgaaaataatctttaa

DBGET integrated database retrieval system