KEGG   Lactobacillus helveticus H10: LBHH_0356Help
Entry
LBHH_0356         CDS       T01959                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lhl  Lactobacillus helveticus H10
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lhl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367208..367780
Genome map
AA seq 190 aa AA seqDB search
MIDAYMRLPGVGEKTATRLAFYTMDMPEKDVEDFSKALIQVKNDIHQCPICGNITEKEVC
DICSNPNRDQTTIMVVEQPKDLMAFEEMGEYDGLYHVLHGVLSPMDGIGPEEINIKSLIT
RLQKNDDVKEVILALNSTPEGESTAMYISKLIKPAGIKVTRLAAGLSVGSDIEYANSITL
KRAVQGRTAL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatgcttatatgaggctgcctggagtaggtgaaaaaacagccactcgtttggct
ttttatacaatggatatgcccgaaaaggatgttgaagatttttcaaaggctttaattcaa
gtgaagaatgatattcatcaatgtcctatttgtggaaatattactgaaaaagaggtctgt
gatatttgctccaatcctaatcgtgatcaaacaactatcatggttgttgaacaaccaaag
gatttgatggcttttgaagagatgggcgaatatgatggcctatatcatgtgcttcacggc
gtcctttcaccaatggacggaattggaccagaagagattaatattaagtcattaattact
cgtttacaaaaaaatgatgatgtaaaagaagtaattttagctcttaactcaactccagaa
ggtgaatctactgctatgtatattagcaagttgattaagccagccggaattaaggtaact
cgtttagcagctggcttgtctgtgggcagtgatattgaatatgctaattccattacttta
aagcgagcagtgcaaggaagaacggcattataa

DBGET integrated database retrieval system