KEGG   Lactobacillus helveticus H10: LBHH_0390Help
Entry
LBHH_0390         CDS       T01959                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBHH_0390 (ruvA)
Enzymes [BR:lhl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LBHH_0390 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399690..400112
Genome map
AA seq 140 aa AA seqDB search
MYGFQSEDDKGLFLKLLSVSGIGPKSALAIMAAEDANSLAEAIEQGEVKYLTRFPGVGKK
TASQIVLDLKGKLRDYVARLDRQDEEQGNIPPALNDALLALIALGYTQKEVDRITPKLEE
VNADTADQYIKKGLALLLKK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgtatggttttcaaagcgaagatgacaaggggctctttcttaagctgttaagcgttagt
gggatcggccctaaaagcgcattggctatcatggcagctgaagatgccaattctttggcc
gaagcaattgagcagggagaagttaagtatcttactcgtttccctggtgtgggtaaaaaa
acggcttctcagattgtgcttgatttgaagggcaagctacgcgattatgttgctcgactt
gatcgtcaagatgaagaacaaggaaatatcccaccagcattgaatgatgccttgttagcg
ttgattgccttgggttatacccaaaaagaagtagatcgaattactcctaagcttgaagaa
gttaatgcggatacagccgatcaatatattaaaaaaggcttggcattactgcttaagaag
tag

DBGET integrated database retrieval system