KEGG   Lactobacillus helveticus H10: LBHH_0561Help
Entry
LBHH_0561         CDS       T01959                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lhl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584856..585686
Genome map
AA seq 276 aa AA seqDB search
MPEMPEVETVRRTLIPLIKGKTIEKVILWYPKIVATDHEKFLSELPGKKIIDIDRYAKYL
LIRLSDNLTIVSHLRMEGKYHLTISDAPKDKHDHVEFIFTDGTALRYNDVRKFGRMQLIL
TGTERQTTGIGKLGYEPNSSEFTSEYLVNGLKRKKKNIKNTLLDQSVVAGLGNIYVDEVL
WRTKIHPLSQANKIPAEKVIELHDQINQIITEAIKLQGTTVHSFLNANGQVGGFQSKLQV
YGHVGEPCPVCGTKFEKIKVNGRGTTFCPHCQVIYK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaatgccggaagttgaaacggttcgaagaactttgattcctttaattaaagga
aaaactattgaaaaagtgattttgtggtatcccaaaatcgtagcgacagatcatgaaaag
tttttatctgaattacctggtaaaaaaatcattgatattgatcgttatgctaagtatttg
cttattcgtttgagtgacaatttgacgattgtttctcatttgcgaatggaagggaagtac
catctaaccatatctgatgcgcctaaagataaacatgatcatgttgagtttatttttacg
gatggaacagccttacggtataatgacgtgcgcaagtttggtcggatgcaattaatttta
actggaactgaaaggcaaactacagggattggcaaattaggttatgaaccaaatagttct
gaatttacatcagaatatttggtaaatggcttaaaacgtaagaagaaaaatatcaaaaat
actttgcttgaccagtcagtagtggccggccttggcaatatttatgttgacgaagtcttg
tggcggactaagatccatcccttgagtcaggctaacaaaatccctgctgaaaaagtaatt
gaattgcatgatcagattaaccaaattattaccgaagcaattaaattgcaaggtacgact
gtccattcctttttaaatgcaaatggtcaagttggcggctttcaaagcaagttgcaagtc
tatggccatgtaggtgaaccttgtccggtttgcggcacgaagtttgaaaaaattaaggtt
aatggtcgaggtaccactttttgccctcattgtcaggtgatttataaatga

DBGET integrated database retrieval system