KEGG   Lactobacillus helveticus H10: LBHH_0708Help
Entry
LBHH_0708         CDS       T01959                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LBHH_0708 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBHH_0708 (pyrB)
Enzymes [BR:lhl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LBHH_0708 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740109..741065
Genome map
AA seq 318 aa AA seqDB search
MKNLNLVALPHFVSVENLRNDEVEALIKRAEYFKKGGAVARLTSPVYVTNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLVMNALGIDLEVIRHSQNEYYEDLIN
LKQHQKLNIGVINAGDGSGQHPSQCMLDMMTIHEHFGHFKGLKVAIVGDITNSRVAKSDM
ELLTKLGAEVYFSGPECWYFEEFDQYGKHEELDKLIPKMDVMMLLRVQHERHSGDPNEKK
FDAHRYHEKYGINHKRYEAMKKDAIIMHPGPINHDVELSGDLVESDKCMFVRQMENGVFM
RMAMLEAVLRGRKLGGLE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttaaatcttgttgctttaccacattttgttagtgttgaaaatttaagaaat
gatgaagttgaggctctgattaagcgtgcggaatatttcaaaaaaggtggagctgtagct
aggttaactagtccggtctatgtcactaacatgttttttgaagattccagtagaactcac
acaagttttgaaatggcagaaagaaaactaggtttaactgtcatcccatttgatccagct
cattcatctgtcaacaagggtgagaccttatacgacacttcactagtgatgaatgcactt
ggcatcgaccttgaagtaattcgccactcacaaaatgaatattacgaggatttgattaat
ttaaagcagcatcaaaaattaaacatcggtgtgattaatgcaggagatggctcaggtcag
catcctagtcaatgcatgcttgatatgatgactattcatgaacactttggccattttaaa
ggtttgaaagtggcaatcgtcggtgacatcactaattctcgcgtagctaaaagtgacatg
gaacttttaactaaactcggtgctgaagtttacttctccggtcctgaatgttggtacttt
gaagaattcgatcaatatggaaagcatgaagaacttgataaattgatccctaaaatggat
gtcatgatgttgctacgggtgcaacacgaacgtcatagcggtgatcctaatgaaaagaag
tttgatgcacatcgttatcatgaaaaatacggtattaatcacaaacgatatgaagcaatg
aaaaaagatgcgatcatcatgcacccgggtccaattaatcacgatgtcgaattaagtggc
gacctggtagaaagtgacaagtgcatgtttgttcgccaaatggaaaacggcgtctttatg
agaatggccatgttggaagcagttttacgtggcagaaaacttggaggacttgaataa

DBGET integrated database retrieval system