KEGG   Lactobacillus helveticus H10: LBHH_0708Help
Entry
LBHH_0708         CDS       T01959                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lhl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lhl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740109..741065
Genome map
AA seq 318 aa AA seqDB search
MKNLNLVALPHFVSVENLRNDEVEALIKRAEYFKKGGAVARLTSPVYVTNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLVMNALGIDLEVIRHSQNEYYEDLIN
LKQHQKLNIGVINAGDGSGQHPSQCMLDMMTIHEHFGHFKGLKVAIVGDITNSRVAKSDM
ELLTKLGAEVYFSGPECWYFEEFDQYGKHEELDKLIPKMDVMMLLRVQHERHSGDPNEKK
FDAHRYHEKYGINHKRYEAMKKDAIIMHPGPINHDVELSGDLVESDKCMFVRQMENGVFM
RMAMLEAVLRGRKLGGLE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttaaatcttgttgctttaccacattttgttagtgttgaaaatttaagaaat
gatgaagttgaggctctgattaagcgtgcggaatatttcaaaaaaggtggagctgtagct
aggttaactagtccggtctatgtcactaacatgttttttgaagattccagtagaactcac
acaagttttgaaatggcagaaagaaaactaggtttaactgtcatcccatttgatccagct
cattcatctgtcaacaagggtgagaccttatacgacacttcactagtgatgaatgcactt
ggcatcgaccttgaagtaattcgccactcacaaaatgaatattacgaggatttgattaat
ttaaagcagcatcaaaaattaaacatcggtgtgattaatgcaggagatggctcaggtcag
catcctagtcaatgcatgcttgatatgatgactattcatgaacactttggccattttaaa
ggtttgaaagtggcaatcgtcggtgacatcactaattctcgcgtagctaaaagtgacatg
gaacttttaactaaactcggtgctgaagtttacttctccggtcctgaatgttggtacttt
gaagaattcgatcaatatggaaagcatgaagaacttgataaattgatccctaaaatggat
gtcatgatgttgctacgggtgcaacacgaacgtcatagcggtgatcctaatgaaaagaag
tttgatgcacatcgttatcatgaaaaatacggtattaatcacaaacgatatgaagcaatg
aaaaaagatgcgatcatcatgcacccgggtccaattaatcacgatgtcgaattaagtggc
gacctggtagaaagtgacaagtgcatgtttgttcgccaaatggaaaacggcgtctttatg
agaatggccatgttggaagcagttttacgtggcagaaaacttggaggacttgaataa

DBGET integrated database retrieval system