KEGG   Lactobacillus helveticus H10: LBHH_0849Help
Entry
LBHH_0849         CDS       T01959                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBHH_0849 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBHH_0849 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBHH_0849 (thrC)
Enzymes [BR:lhl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBHH_0849 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888280..889770)
Genome map
AA seq 496 aa AA seqDB search
MKYRSTRGSKENTLNSAAAIIQGLAPDGGLYVPLDFPKANFKLEDLPKLSYKQIAAMVIS
LFFNDYSKEQIQSAVLNAYSEQWDNRSIVPIEKHDHNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIDRNIIILTATSGDTGTASMRGFANQKRTSVIVFYPEGGVSPVQLRQMLS
QHGDNLQAIAIKGNFDDAQTEVKKIFNDEKFKTLLNKNGYQFSSANSMNIGRLVPQISYY
LYTYGQLVRRQEIKLGNEINFSVPTGNFGDILAGYYAKKLGLPIKKLICASNENNVLTDF
FKNGEYDRRRKFHLTNAPAMDILVSNNLERLLFDLYDNDYKQISSLMNQLTQRGHYQISD
EVHAKLQEIFAADFATERQVIKEINRIYNYDRYVIDPHTAVGSYVAHQYQEKTGDTTPMV
IVSTASPYKFPETVYEAVTGRVCPQTGVAAIKKLHEELGGQLSIGVRTLFDRKPGLEKVI
DPQNMEIVISSILDLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggttcaaaagaaaatactttaaattcagctgctgctatt
attcagggattagctcctgatggtggattatatgttccactggattttcctaaggctaat
tttaaattagaagatttaccaaaattatcttataaacagatagccgcaatggtaattagc
ttattttttaatgattattctaaagaacaaatacaaagcgctgtacttaacgcatatagt
gaacaatgggacaaccgcagcattgtccctattgaaaagcatgatcataatttttacatg
gaattattccacggaccaactcttgcttttaaagatattgctttacaaatgttgccccaa
ttaatgactcgagctgtacaaattgaaaaaattgatcgcaatattatcatcttgactgct
acttctggagatacaggtacagcttccatgcgcggatttgctaatcaaaaacgcactagc
gtgattgtcttctatccagaaggcggtgttagtccagtacagcttcgtcaaatgctcagt
cagcatggcgacaatttacaagcaattgctattaaaggaaactttgacgatgcccaaacc
gaagtaaagaaaattttcaacgatgagaaatttaaaactttattaaataaaaacggctat
caattctcctctgctaattcaatgaacattggtcgacttgtccctcaaatttcttattat
ctttacacatacggtcaattagtgcgaagacaagaaatcaaattaggcaatgaaattaac
ttttctgtacctacaggtaattttggggatattttagctggctactatgccaaaaagtta
ggattaccaattaaaaaattaatttgtgcttcaaatgaaaacaatgttcttaccgatttc
tttaaaaatggtgaatatgaccgtcgtcgcaaattccatttaaccaacgcacctgcaatg
gatatcttggtttctaacaatcttgaacggctcttgtttgatctttacgataatgactac
aaacaaattagcagcttgatgaatcaactgactcaacggggccactatcaaatcagtgat
gaagttcacgctaaacttcaagaaatctttgccgctgattttgcaacagaaagacaagtt
attaaagaaatcaatcgcatctataattatgaccgttacgtaattgatccccatactgcg
gttggttcttatgttgctcaccaatatcaagaaaagaccggtgatacaacgcctatggta
attgtatcaactgctagtccatataaattcccagaaacagtatatgaagcagtaactggt
cgcgtgtgccctcaaacaggagttgcagctatcaagaagctccatgaggaattaggtggt
caattatcaattggagtgcggaccttatttgatcgtaaacccggcttggaaaaagtaatc
gatccacaaaatatggaaatagtaattagctcaattttagacttaaaataa

DBGET integrated database retrieval system