KEGG   Lactobacillus helveticus H10: LBHH_1080Help
Entry
LBHH_1080         CDS       T01959                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBHH_1080
   01230 Biosynthesis of amino acids
    LBHH_1080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_1080
  Energy metabolism
   00680 Methane metabolism
    LBHH_1080
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBHH_1080
Enzymes [BR:lhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBHH_1080
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBHH_1080
  Exosomal proteins of melanoma cells
   LBHH_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1136366..1136911)
Genome map
AA seq 181 aa AA seqDB search
MKVCEGWANYNLTELGRKQARATCNYLAENYIFDKIYVSTLNRAIQTAEYLAANTHLSLN
KTDELKEFNNGLRAKLPYNEAYTKYPNVPTPIHTSNYEQETELHFRMRAESFLSRVITEN
DSKSTIAIVSHGGMIMRLYESFLGLPMNSNVKFTSGDACFHEWKLTDGQRFINKANCCVY
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtgtgtgaaggttgggcaaattataatctaacggagttaggtcgtaagcaggct
agggccacttgcaattatctcgctgaaaactatatttttgacaaaatttatgtcagtact
ttaaatcgggcaattcaaaccgctgagtatttagcggcaaatacacatctttctttgaat
aaaaccgatgaacttaaggaatttaacaatggtcttagagcaaagttaccatataatgaa
gcttacactaagtatcctaatgttccgacacctattcatacctcgaattatgaacaggag
accgaattgcattttagaatgcgggcggaatcatttttatctagagttataacagagaat
gattctaaaagtacaatagctattgtctctcatggtggaatgatcatgagattgtatgaa
tcttttctaggattacctatgaattcaaatgttaaatttacctctggagatgcctgtttt
cacgaatggaaattgactgatggacaacgatttataaataaagctaattgctgtgtctat
aagtaa

DBGET integrated database retrieval system