KEGG   Lactobacillus helveticus H10: LBHH_1153Help
Entry
LBHH_1153         CDS       T01959                                 

Definition
(GenBank) 6-phosphofructokinase isozyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00010  Glycolysis / Gluconeogenesis
lhl00030  Pentose phosphate pathway
lhl00051  Fructose and mannose metabolism
lhl00052  Galactose metabolism
lhl00680  Methane metabolism
lhl01100  Metabolic pathways
lhl01110  Biosynthesis of secondary metabolites
lhl01120  Microbial metabolism in diverse environments
lhl01130  Biosynthesis of antibiotics
lhl01200  Carbon metabolism
lhl01230  Biosynthesis of amino acids
lhl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_1153
   00030 Pentose phosphate pathway
    LBHH_1153
   00051 Fructose and mannose metabolism
    LBHH_1153
   00052 Galactose metabolism
    LBHH_1153
  Energy metabolism
   00680 Methane metabolism
    LBHH_1153
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LBHH_1153
Enzymes [BR:lhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBHH_1153
Protein phosphatases and associated proteins [BR:lhl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBHH_1153
Messenger RNA biogenesis [BR:lhl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LBHH_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADX70355
UniProt: F0NTC6
Position
complement(1209722..1210684)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
ISEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAIDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERPYDVKEIAETITRGFADGKDHGIIVLAEGVMTADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGMENGQLSTHDILDLF
DGKHHGDYALLDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggcggagacgcccctggtatgaatgcagcaatt
agagctgtcaccaagactgctatccatcatggacttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggtgactttgttccgcttactacggaaaatgttgaccacaag
ataagtgaaggcggtacatttttgtacagtgcccgcttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgtggagcaattgaagaaacatggtattgatgctgttatcgttatt
ggcggtgacggatcttaccacggtgctttagccttgactcgccacggcgtaaactcagtt
ggtttaccagggactatcgataatgatattccttataccgactacacgattggctttgat
tctgcttgtcgtactgctatagacgcaattgataagattcgcgacacagcaagtagtcac
caccgcgttttcgttgttaacgtaatgggacgtgaatgtggtgatatcgctatgcgtgtt
ggtgtagctagtggtgcagatgcaattgttattcctgaacgtccatacgacgttaaagaa
attgcagaaactatcactcgtggttttgcagatggcaaagatcatggtatcattgtttta
gcagaaggtgtcatgaccgctgataagtttaaggatgaattacttaaatacggcgatttt
gatgctcgtgctaatgtccttgcgcatatgcaacgtggtggctcaccaacagtcacagat
agagttaatgctactaagatgggtaactatgctgttaagttgcttctcgatgggaagggc
ggtttagctgtcggcatggagaatggtcaacttagtacccacgacattcttgatctgttt
gacggaaaacaccatggcgattatgcgttattggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system