KEGG   Lactobacillus helveticus H10: LBHH_1216Help
Entry
LBHH_1216         CDS       T01959                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lhl  Lactobacillus helveticus H10
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lhl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lhl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1280010..1280540)
Genome map
AA seq 176 aa AA seqDB search
MRWKMIEFVWAEDQKHQIGLDGHLPWRLPADMAHFKEKTIGHPIIMGRKTFMSLPRLLPQ
RKHIVLTHDQDLKKKYQDNDQVTIINSIAELGDYIQNHQGEKLCAVGGVSIFKALLDQVD
VLEKTEIDATFEADTVMPEIDYDQFKLVKKEHHEADEKNKYPYTFFTYQRKIKSIK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagatggaaaatgattgaatttgtttgggcagaagatcaaaaacatcagataggttta
gatggacatttgccgtggcgattgcctgcagatatggctcattttaaggagaaaacgatt
ggtcatccaattatcatgggaagaaaaactttcatgagtttgccaaggttattgcctcag
agaaagcatatcgttttaacccatgatcaagatttgaaaaagaagtaccaagataatgat
caagtaacaattattaattcgatagcagaactaggtgattatattcaaaatcatcagggt
gaaaagctttgtgcggttggtggggtgtcaatttttaaggcattgcttgatcaagtggat
gttttagaaaaaacggagatcgacgctacttttgaagcggatacggtgatgccggagata
gattatgatcagtttaaattggtgaagaaagaacatcatgaagctgatgaaaagaataaa
tatccgtacactttttttacttatcagagaaaaattaaatccattaaataa

DBGET integrated database retrieval system