KEGG   Lactobacillus helveticus H10: LBHH_1240Help
Entry
LBHH_1240         CDS       T01959                                 

Gene name
bglA2
Definition
Phospho-beta-galactosidase I
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_1240 (bglA2)
Enzymes [BR:lhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LBHH_1240 (bglA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304538..1305983
Genome map
AA seq 481 aa AA seqDB search
MYSAKMPKNFLWGGAVAAHQLEGAWKEGGKGVSVADVMTIGSATKPREITDGVLPGKNYP
NHSAIDFYHHYKEDIKLMAEMGFKAFRTSIAWTRIFPNGDEKEPNEEGLKFYDGLFDTCH
KYGIEPVITLSHFEMPFNLAKNYGGFTNRKVIDFFVRFAEVCFKRYKNKVKYWMTFNEID
NQSAFNNDFLMATNSGILFKDGMTDHDKEAAMYQAGHYELVASALAVKIGHKINPNFQIG
CMINYSPVRPLTPSSDDVLLADKWEQRRDWFSDVHVFGEYPNAVEAYIERNGYRPDITDE
DRIVLKEGTVDYVGFSYYQTTTVSSEKVKPDDLTDLAKAVAKNPTLKRSDWGWEIDPEGL
RIALNQLQDRYHKPLFIVENGLGAYDKVEDGKVRDDYRIDYLRNHISEMEKAVELDGVDL
MGYLPWGCIDLVSAGTGQMDKRYGFIYIDKNDVGEGTLARSRKDSFFWYKKVIESNGKDL
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtattcagcaaaaatgccaaagaactttttatggggtggcgctgtagctgctcaccaa
cttgaaggtgcttggaaagaaggcggcaaaggagtttctgttgccgatgttatgactatt
ggttctgctactaagccacgtgaaatcactgatggcgtgcttccaggcaagaactatcct
aaccactcagctattgatttctaccaccactacaaggaagatattaagttaatggctgaa
atgggctttaaagctttcagaacttccattgcttggactagaattttccctaatggtgac
gaaaaagaacctaatgaagaaggtttgaagttttatgacggtttatttgatacctgtcat
aaatatggcattgagcctgtaattaccctctcccactttgaaatgccattcaaccttgct
aagaactacggtggttttaccaatcgtaaggtaatcgacttctttgtacgttttgcagaa
gtttgcttcaagcgttacaagaacaaggttaagtactggatgactttcaacgaaatcgat
aatcaatcagcatttaacaatgacttcttaatggctactaactcaggcattcttttcaag
gatggtatgactgaccatgataaggaagctgcaatgtatcaagctgggcactacgaatta
gttgcttccgcattagctgttaagattggccacaagatcaaccctaacttccaaattggt
tgtatgatcaactactcacctgttcgtccacttactccatcaagtgacgatgttctttta
gctgataaatgggaacaacgtcgtgattggttctcagacgttcacgtttttggtgaatat
ccaaatgcagttgaagcttatattgaaagaaatggctaccgtcctgacatcactgatgaa
gacagaattgtcttaaaggaaggtaccgttgactatgttggcttcagctactaccaaact
actacagtttcaagcgaaaaagttaagcctgatgacttaactgatttggcaaaagctgta
gctaagaaccctactttgaagcgtagtgactggggttgggaaattgacccagaaggtttg
agaattgccttaaaccaattgcaagatcgttaccacaagccactattcatcgttgaaaat
ggtcttggtgcttacgacaaggttgaagacggcaaggttcgtgatgactacagaatcgac
tacttaagaaaccacatttcagaaatggaaaaggctgttgaactcgatggtgtcgactta
atgggttaccttccatggggctgcatcgacttagtttctgctggtactggtcaaatggac
aagcgttacggctttatctatattgataagaatgatgtcggtgaaggtaccttagcacgt
tcacgtaaggattcattcttctggtacaagaaggtcatcgaatcaaacggtaaagactta
gactaa

DBGET integrated database retrieval system