KEGG   Lactobacillus helveticus H10: LBHH_1279Help
Entry
LBHH_1279         CDS       T01959                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBHH_1279
Enzymes [BR:lhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LBHH_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1346425..1348776)
Genome map
AA seq 783 aa AA seqDB search
MSEFTGKINGIVFENDKDLYKILDVEIIGSLENYSRSEIKVTGNFGDVQIGSSYHFDGKL
IMHEKFGLQFRANSYKPIMPHEEGSLTNYLSSNKFPGIGKKTAGTIIEELGLNALDILKE
NPAKIDTLSLTKKQKDSLLSGLNSMDSYSEIVLKLAQYGIRKQVAARLYQCYHGAALDKL
KEDPYAAINEVTGYGFKTADTLGKQLDIKNDDPRRINGAIYQILLDALSGEGDTYVSLSE
LLTAAKDLLQISEFDPIAICVNSLQKKGKIVVDGENAFLQNIYQTEVDIARSMKSLVESR
KLQEDKQYSDKKIEEAIKDAEQELKIEYDDTQKLAIKNALNNPISILTGGPGTGKTTIIN
GILLALRKLAEIPASSLYSEDPPFLLAAPTGRAAKRMGEITGISAKTIHRLLGLGIGDAN
AEDLNELNGEILIIDEMSMVDMFLFKQLLSSINQTRHIVFVGDKDQLPSVGAGNVFSDLI
KSHAFPTTVLKQIHRQGDESTIITLAHDVNEGKDQQALFKKTKNYSFISCRPELVGDAVG
QIVKLALKRGFDKDDVQVLSAMYHGSGGVNNLNDVIQEIMNPPKAKSKFLEVRNEVFRIG
DRILQLQNNPEKDIYNGQIGKIISIDEDNSKECMVANFDGREVSFGKKDLTDLTRAYAIT
IHKSQGSEFPLVILNLTMQNYVMLKRNLLYTAITRAEKNLVLVGDPRAFAAAFNTPGNDR
KTGLAEKICAQLGIKDVKADENTKEEVVESKPQKQEPQDYILTPEKIYSGEIDPMIGMEN
IKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattcaccggtaaaattaacgggattgtttttgaaaacgataaagatttatac
aaaatcctcgatgttgaaatcattggttcactcgaaaattattcacgtagcgaaattaag
gtaacaggaaattttggtgacgtgcaaattggaagtagctatcattttgatggcaaactg
attatgcacgaaaaatttggtttgcaatttcgtgctaatagttataaaccgatcatgcct
catgaagaaggttcacttactaattatttaagttctaataaatttccaggtattggtaaa
aaaacggcaggtaccattattgaagaattaggattaaatgctttagacattttaaaagaa
aatcctgccaaaatcgacaccttatctttaaccaaaaaacaaaaagatagtttattgtca
ggccttaattctatggattcttattccgaaattgttttaaaattggcacaatatgggatc
aggaaacaagtagccgctagactttatcaatgttatcatggtgcagctttagataaatta
aaagaggatccatatgctgctattaatgaagttacaggttatggctttaagactgcagat
accttgggcaaacaattagatattaaaaatgatgatccacgaagaataaatggtgccatt
tatcagattcttttggatgctttaagcggtgagggagatacatatgtctcactatccgag
ctgttaactgctgccaaagatttattacaaatttcagagtttgatccgattgctatttgt
gtaaattctttacagaaaaaaggaaaaatagtagttgatggtgaaaatgcctttttgcaa
aatatttatcaaacagaagtagatattgctcgatctatgaaaagcttggtagagagcaga
aaactgcaagaagataagcagtatagcgacaaaaaaattgaagaagccattaaagatgcg
gaacaagagttaaagattgaatacgatgatacacagaaattagcaattaaaaatgctttg
aacaatcctatttcaattttgacgggtggtcctggtacaggaaaaactacgattattaat
ggaatattactggcattaaggaaattagcagaaatcccagcttcatcgctatatagtgaa
gatccaccatttttattagcggcgccaacaggtagagctgcaaagagaatgggtgagata
actggcattagtgctaaaaccatccaccgtcttttaggattggggattggagacgcaaat
gccgaggatttgaatgaactcaatggtgaaatcttaatcattgatgagatgtcgatggtt
gacatgttcctatttaagcagcttctctctagtatcaatcaaactcgacacattgtgttt
gtgggggataaggatcagttgccttctgttggtgcaggaaatgtatttagcgatttaatt
aagtcacatgcttttcctactacggtattaaagcagattcaccgacaaggtgatgaatca
acgattattacattggctcatgatgtaaatgagggcaaagatcaacaagctttattcaaa
aagactaagaattattcatttattagctgtagacctgaattggtaggggatgcagtaggt
caaattgtaaaattggctttaaaacgtggcttcgataaagacgatgtacaagtattaagt
gcaatgtatcatggtagcggcggggtaaataatttgaatgatgttattcaagaaataatg
aatccacccaaagccaaaagtaaattcttagaagtgcgtaatgaagtctttcggattggc
gatcgaattttacaattacaaaataatcctgagaaagatatctataatggtcaaatcggt
aagataattagtatcgatgaagataattctaaggaatgcatggttgctaattttgacggt
cgggaagtaagttttggcaaaaaagatttaacagacttgaccagggcgtatgcgattact
attcataagtcacagggctcggaatttccgttagtaattttgaatttgactatgcaaaat
tatgtgatgcttaaacgaaacttgctttatacggcgattactcgtgctgagaaaaattta
gttttagtaggagatccgcgagcttttgcggcagcttttaatacaccaggaaatgatcga
aaaactggattggcagaaaaaatctgtgctcaattgggtattaaagatgttaaggctgat
gagaacacgaaagaagaggtagttgaatcaaagcctcaaaaacaagaaccacaagattat
atcttaacgcctgagaaaatttattcaggtgagatcgatccaatgattggaatggaaaat
attaaactataa

DBGET integrated database retrieval system