KEGG   Lactobacillus helveticus H10: LBHH_1531Help
Entry
LBHH_1531         CDS       T01959                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBHH_1531
Enzymes [BR:lhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBHH_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1602982..1603914)
Genome map
AA seq 310 aa AA seqDB search
MLMKKIVVIGSSNVDTTLHVKDFPKPGETINATEITSAGGGKGANQAIAAAKSGAETYFI
NRVGEDSEGGYITHQLKSYGVDTTYVQTTMGSKTGHAYITLNEAGQNDIIIDHGANYELT
VEDIQAASDLFKDVDCVIAQFETPLEVTIEAFKLAKKAGKITILNPAPAIDKIPKELLQY
TDIITPNETESDKITGIQIKDNSTLATNAEKLHLLGVKNVVITYGDKGAYISSADIETLV
PAYKVEATDTTGAGDTFIGYLASNLKPDLSNFEAAAKIANRASSIAVQRLGAQPSIPTAK
EVEEAMEDNE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgaagaagattgtagttattggttcaagcaatgtagatactacattgcacgta
aaggactttccaaaaccaggtgaaacgattaacgccacagaaataacttctgctggtggt
ggtaaaggtgcaaaccaagccatcgccgcagctaaaagtggtgcggagacttattttatt
aatcgtgtcggtgaagacagcgaaggtggttatatcacccatcaattgaagagttatggc
gttgacactacctatgttcaaaccacgatgggaagcaagactggtcatgcttatattaca
ttaaatgaagcaggacaaaatgatattattatcgatcatggtgctaactatgaattgacc
gttgaagacattcaggctgctagtgatttgtttaaagatgttgactgtgttattgcccaa
ttcgaaacgccacttgaagtaacaattgaggctttcaagttagctaaaaaggcaggaaaa
atcacaattttaaatcctgctcctgctattgataagattccaaaagagttgttgcaatac
acagatattattacgccaaatgaaactgaaagtgacaaaattacgggcatccaaataaag
gacaattcaactttggcaacgaatgctgaaaagttgcatcttcttggcgttaaaaacgta
gtaattacatacggtgataaaggtgcatatatttcatctgcagatattgaaaccttagtt
ccagcttataaagttgaagcaactgataccactggtgcaggcgatacctttattggttat
ttagcaagcaacttaaagccagacttatctaattttgaagcagctgccaagattgctaat
cgtgcctcatcaattgcagttcaacgcttgggtgctcaaccttcaattcctactgccaag
gaagtagaagaagccatggaggataatgaataa

DBGET integrated database retrieval system