KEGG   Lactobacillus helveticus H10: LBHH_1636Help
Entry
LBHH_1636         CDS       T01959                                 

Gene name
adhE
Definition
Putative aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LBHH_1636 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_1636 (adhE)
   00620 Pyruvate metabolism
    LBHH_1636 (adhE)
   00650 Butanoate metabolism
    LBHH_1636 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LBHH_1636 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBHH_1636 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBHH_1636 (adhE)
   00626 Naphthalene degradation
    LBHH_1636 (adhE)
Enzymes [BR:lhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBHH_1636 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LBHH_1636 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1718651..1721275)
Genome map
AA seq 874 aa AA seqDB search
MAKTQPKETQTEEEKKKQIYDMVDNLVKRSHVALDEMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIILGFHPQAQKCCVETGEIIQAAAVAAGAPKDA
IQWIEEPSLDATTDLMNNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKTAN
IDRAVYDIVLSKNFDNGMVCASENSVVVDNEIYDQVKEEFKKWSCYFLNKEEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKETKVIVAEYKGVGRKFPLSAEKLSPVFTLY
RAKDHDDAFRICSELLDYGGRGHTAGLHSSDQKVIKEFSMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGARDLLNIKTVAKRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADQGFADEITDIISKRRGQKEYEVFKAVTLDPSTDVIKDGV
HRMNIFKPDVVIAIGGGSVMDAAKVMRLFYENPEMKFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAVISDAKTGIKHTLCDYALTPDVSIVDDQFVQDLPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKIIFANLKKSYDGDLDARKKMHDAATIAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVICFNAKRPEKLAMWPHYSVYRADKD
YAEIARAIGLTGSSDAELIEKLVQKIIDLAQSVGIKMAYKDYGVDENEFNKKVDQLAVEA
YGDQNTVTNPVAPLISQIAQLMRDSFEGKDIKTK
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacacaaccaaaagagactcaaacagaggaagagaagaaaaagcaaatttac
gacatggttgataatttagtaaaaagatcacatgtcgctttagatgaaatggccaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgcaggtgaacaaaatgct
tacccactagctaagatggctgttgaagaaactaagcgtggtgtggtagaagacaagact
accaagaacatgtacgctagtgaaaatatttggaacagtttgcgtcacgaaaaaactgtt
ggtgtaattgaagaagataaagaattaggtttaaccaagattgctgaacctaagggtgtt
atcgctggtgttactccagtaacaaacccaacttcaactgttatcttcaaagctatgctt
gctttaaagactagaaatactattattttaggcttccacccacaagctcaaaagtgttgt
gtagaaactggtgaaattatccaagctgctgctgtagctgctggtgctccaaaagatgcc
attcaatggattgaagaaccaagtttggatgctactactgatttgatgaataacccaggc
gttcaaactatcttggctactggtggtcctggtatggttaaggccgcatattcatcaggt
aagccagctatcggtgttggtcctggtaatggtccttcatatattgaaaagactgctaat
attgaccgtgccgtttatgacattgttttgtcaaagaacttcgataatggtatggtttgt
gcttctgaaaactcagttgttgtagataatgaaatttacgaccaagttaaggaagaattc
aagaagtggagctgctacttcttgaacaaagaagaaattaagaagtttgaagaacacttc
atcgatccaagacgtggtactgttgcaggtcctgtagctggtaagtcggcttatgaaatt
gctaagctctgcggcgttgatgtaccaaaggagaccaaggttattgttgctgaatacaag
ggcgttggtagaaaattcccactttcagctgaaaagctttcaccagtcttcactttatac
cgtgctaaggatcatgatgatgccttcagaatttgttcagaattgcttgattacggtggc
cgtggtcacactgctggccttcactcaagtgatcaaaaggtaatcaaagaattctcaatg
aagatggatgcatgtcgtatcttggttaactcaccagctgctcttggtggtatcggtgat
ctttacaacaacatgctcccatcacttaccttgggtactggttcatatggtgctaacacc
ttctcacacaacattggtgctcgcgacttgcttaacattaaaactgttgctaagcgccgc
gacaatatgcaatgggtaaaggtaccatcaaagacctacttcgaacataacgctgctaac
tacttgcgtcacatgccaaatgttaaccgtttcttcatcgttactgacgaaggcgtagct
gaccaaggctttgctgacgaaattactgacattatttctaagcgtcgtggtcaaaaagaa
tacgaagtcttcaaggctgtaacgcttgatccaagcaccgacgttattaaagatggtgtt
cacagaatgaacatcttcaagccagatgttgttattgccatcggtggtggttcagtaatg
gacgctgctaaggtaatgcgtttattctacgaaaatccagaaatgaagtttgaggaagct
taccaaaagtttttggacatcagaaaaagagtagttcgcttcccaaagattaacggcgtt
caacttgtatgtattccaactacttcaggtactggttcagaagtttcaccaattgccgtc
attagcgatgctaagactggcattaagcacactctttgtgactatgctttgactccagat
gtttcaattgtcgatgaccaattcgtacaagatttgcccaaacgcttgattgcttggtca
ggctttgaagctttaggtcacgcaatcgaaagttatgtttcaactatggctactgacttt
actcgtggctggtcacttgaagctattaagatcatcttcgctaacttgaagaagtcatac
gatggcgatcttgatgctcgcaagaagatgcatgatgcagctactattgctggtatggca
tattcaaacgcattccttggtttggaacattcaattgcccacaccgttggttcaaccttt
gatattccaagtggtgttagcgatgctattgctttgccacaagttatctgcttcaatgct
aagcgcccagaaaaacttgctatgtggcctcattactcagtttaccgtgctgacaaggac
tacgcagaaattgctagagctatcggtttgactggctcaagtgatgctgaattgattgaa
aaattagttcaaaagattatcgacttggctcaatcagttggtatcaagatggcctacaag
gattacggtgttgatgaaaatgaatttaacaagaaggttgaccaattagctgttgaagct
tacggtgaccaaaacactgtaactaatccagttgctccattaattagtcaaattgctcaa
ttgatgagagacagctttgaaggtaaagatattaagactaagtaa

DBGET integrated database retrieval system