KEGG   Lactobacillus helveticus H10: LBHH_1644Help
Entry
LBHH_1644         CDS       T01959                                 

Gene name
galA2
Definition
(GenBank) Alpha-galactosidase 1
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00052  Galactose metabolism
lhl00561  Glycerolipid metabolism
lhl00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBHH_1644 (galA2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBHH_1644 (galA2)
   00600 Sphingolipid metabolism
    LBHH_1644 (galA2)
Enzymes [BR:lhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LBHH_1644 (galA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36C
Motif
Other DBs
NCBI-ProteinID: ADX70819
UniProt: F0NVU7
Position
complement(1727774..1728295)
Genome map
AA seq 173 aa AA seqDB search
MKIQYGTSLVYPINMMGAQVSVSPNEQNGRYISLATRYAVAMSGDLGCELDLTKLSEQDS
SEIKEEINRYKKLRHLIQFGDFYRLKSPFNSNQAAWNFVSKDKKEVLVMNFNIMSQAQPI
FTKTKLYGLDPDLDYCDESTGQIYGGDELMEAGYYDSVMKRDFTSEVKYFIAL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccaatatggcactagtttggtttatccaatcaatatgatgggagcccaggta
tcggtgagtcctaatgaacaaaatggtcgttatatttcacttgcaacgcgttatgccgtt
gcgatgagtggtgatttgggctgtgaattagatttgactaaattatcagagcaagactct
tctgaaataaaggaagaaattaacagatataaaaaattacgtcatttaattcagttcggc
gacttctatcgtttgaaatcaccgtttaacagtaatcaagctgcatggaattttgtctct
aaagataaaaaagaagtgctagtgatgaactttaatattatgtcgcaagctcagccgatt
tttactaaaacaaaattgtatggtttagatcccgatcttgattattgcgatgaaagcaca
ggtcaaatttatggtggggatgaattaatggaagcaggctactacgattccgttatgaag
cgggattttacgtcagaagtaaaatactttattgctttgtaa

DBGET integrated database retrieval system