KEGG   Lactobacillus helveticus H10: LBHH_1644Help
Entry
LBHH_1644         CDS       T01959                                 

Gene name
galA2
Definition
Alpha-galactosidase 1
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lhl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lhl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lhl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1727774..1728295)
Genome map
AA seq 173 aa AA seqDB search
MKIQYGTSLVYPINMMGAQVSVSPNEQNGRYISLATRYAVAMSGDLGCELDLTKLSEQDS
SEIKEEINRYKKLRHLIQFGDFYRLKSPFNSNQAAWNFVSKDKKEVLVMNFNIMSQAQPI
FTKTKLYGLDPDLDYCDESTGQIYGGDELMEAGYYDSVMKRDFTSEVKYFIAL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccaatatggcactagtttggtttatccaatcaatatgatgggagcccaggta
tcggtgagtcctaatgaacaaaatggtcgttatatttcacttgcaacgcgttatgccgtt
gcgatgagtggtgatttgggctgtgaattagatttgactaaattatcagagcaagactct
tctgaaataaaggaagaaattaacagatataaaaaattacgtcatttaattcagttcggc
gacttctatcgtttgaaatcaccgtttaacagtaatcaagctgcatggaattttgtctct
aaagataaaaaagaagtgctagtgatgaactttaatattatgtcgcaagctcagccgatt
tttactaaaacaaaattgtatggtttagatcccgatcttgattattgcgatgaaagcaca
ggtcaaatttatggtggggatgaattaatggaagcaggctactacgattccgttatgaag
cgggattttacgtcagaagtaaaatactttattgctttgtaa

DBGET integrated database retrieval system