KEGG   Lactobacillus helveticus H10: LBHH_1761Help
Entry
LBHH_1761         CDS       T01959                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00230  Purine metabolism
lhl01100  Metabolic pathways
Module
lhl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBHH_1761
Enzymes [BR:lhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBHH_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ABC_tran RsgA_GTPase AAA_23 Zeta_toxin dNK Rad17 AAA_29 ATPase AAA_22 AAA_24 AAA_17 PRK AAA_28 AAA_14 TsaE NTPase_1 AAA_16 AAA PduV-EutP T2SSE Cytidylate_kin APS_kinase
Motif
Other DBs
NCBI-ProteinID: ADX70931
UniProt: F0NWK8
Position
complement(1858721..1859281)
Genome map
AA seq 186 aa AA seqDB search
MGDFLLKKIILIAGPSGAGKTTISDYLNEKCGIPRVLTHTTRPMRPGEKQNFSYHFETDE
SFKTLHFFEHIRYGSYQYGSSREALNLAWKKSDLVSLIVDIKGVYTYLKQLGNKVYFLYV
TTSTKEELKERLLKRGDDPEKIKERLSGSELNLLPKDLKEYAHILVNDNLSETKSKLDSI
VSRLEK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgggggactttcttttgaagaaaataattttaatcgcgggcccgagcggtgccggaaag
acaacgatttctgattatttaaatgaaaaatgtggtataccgcgtgtcttgacacatacg
acgcgtccaatgagaccaggggaaaagcagaatttctcctatcattttgaaacggatgaa
agcttcaagacactgcacttttttgaacatattagatatgggtcttatcaatatggttca
agtcgtgaagccttaaacctcgcttggaaaaagagtgatctcgtttctttaattgtcgat
attaaaggtgtttacacttatctaaaacaattaggtaataaagtttatttcctttatgtg
acaacttcgacgaaggaagagctaaaagagcgccttttaaagcggggagacgatcccgaa
aaaatcaaagagcgactcagcggcagtgaattaaacttattgccgaaagacttgaaagaa
tacgctcacatattagttaatgataatctatcagaaactaagagtaagctggattcaatc
gtatcaaggcttgaaaagtga

DBGET integrated database retrieval system