KEGG   Lactobacillus helveticus H10: LBHH_1943Help
Entry
LBHH_1943         CDS       T01959                                 

Gene name
glpK
Definition
Glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBHH_1943 (glpK)
Enzymes [BR:lhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBHH_1943 (glpK)
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBHH_1943 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046983..2048248)
Genome map
AA seq 421 aa AA seqDB search
MAEQYILSIDEGTTSTRAILFDHNGKEVASAQKEIPQYFPEPGWVEHDAHQIWIAVQTTI
ANAFINSGIWPSQIAAIGITNQRETTVVWDKDTGNPIYHAIVWQSRQTTKLAEKLKKEGY
SEKIRQKTGLIIDPYFSATKIRWILDHVPGAQEKAEQGKLLFGTIDSWLVWKLTNGQKHV
TDYTNAARTMLFNIHTLEWDDDILKLLNIPKQMLPEVRSNSEIYGETADCMFFGGTVPIA
GMAGDQQAALFGQLALKPGMVKNTYGTGAFIVMNTGEKPTDSNNNLLTTIGYGINGKITY
ALEGSIFVAGSAIQWLRDSMKLIKHAPNSEQAAYESTSENEVYVVPAFTGLGAPYWDAEA
RGSIFGVTRGTTDKDIIKATLQSLAYQTRDVVDTMQKDSGIKIQELRVDGGASNNNYLMQ
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaatatattttatcaattgatgagggaaccacttcaactagagctattctg
tttgatcataatggaaaggaagtagcttctgctcaaaaagaaataccccaatattttcca
gaaccaggttgggtagaacatgatgctcatcaaatttggatagcggtacaaacgacgatt
gctaacgcgtttatcaattcaggtatttggcctagtcaaattgcggcaattggtattact
aatcaacgtgaaacgacggttgtttgggataaagacacaggtaaccctatttatcatgca
attgtttggcagtcacgtcagacgactaaattagccgaaaagcttaaaaaagaaggctat
agcgaaaaaatcaggcaaaaaacaggcttaattattgacccatattttagtgcaactaag
attcgctggattttggaccatgttcctggtgctcaagaaaaggcagaacagggcaagctt
ttattcggcaccattgatagctggttagtatggaaattaactaatgggcaaaaacatgtg
acagattatactaatgccgcaaggactatgctttttaatattcacacgcttgagtgggat
gatgatattttaaagttattaaacatccctaagcagatgctgccagaagtacgttctaat
tcagaaatttatggtgaaactgcagactgcatgttctttggcggtactgtgccaattgca
ggaatggctggtgaccaacaagccgctttatttgggcaactggctttaaagccaggcatg
gtaaagaatacttatggtaccggtgcctttattgtgatgaatactggtgaaaagccaacg
gattccaacaataatttgcttactaccattggttatggcattaatggcaaaatcacctat
gccttagaaggatcaattttcgtagcaggtagcgcaattcaatggctgcgtgattcaatg
aagctgattaaacacgcaccaaattctgagcaagcagcttatgaatcaacttcagaaaat
gaggtctatgttgtaccagcatttacagggctgggtgcaccttattgggatgcggaagca
cgcggatcaatttttggcgttacacgtggaacaacagataaagatattatcaaagctact
ttgcaatctttggcttatcaaactcgggatgtagttgatactatgcaaaaagattctggt
attaagatccaagagctgcgagttgatggtggtgcaagcaacaataactatttgatgcag
ttttag

DBGET integrated database retrieval system