KEGG   Lactobacillus helveticus R0052: R0052_01325Help
Entry
R0052_01325       CDS       T02217                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    R0052_01325
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    R0052_01325
Enzymes [BR:lhr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     R0052_01325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240181..241476
Genome map
AA seq 431 aa AA seqDB search
MKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIVDVANLMDLLSEM
DVHCDFGETTLRIDPENIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMPSVGATMNIIMASVTAQG
QTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVDMLKAQIPHTIIPDRIEAGT
YVSLAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVINADEDSLYVYPAGDLKMVQVKTDV
YPGFATDLQQPITPLLLTAKSGEGVVIDNIYPKRNGHIPQLQKMGADIKVEDNIILAHPT
KQLHGAEVTAGEIRAGACLMIAGLMASGTTVIDKAGNILRGYDRVQEKLRQLGADVTIKD
DPSEPGILDNI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagatgattattcatggtggaaagcctctacaaggtgatgtttggattggtggc
gccaagaactctacagttgcgctcattccagcatcgattttgtcaagaacaccagtaact
ttggaaggcgtcccaaggattgttgatgttgccaacttaatggatttattaagcgagatg
gatgtacattgtgattttggagaaactacattacgtattgatccagaaaatatcaagatg
agtccattaccagctggtaagattaagagtttgcgtgcatcgtattacttcatgggtgca
cttcttggtcgttttggcaaggcagtagtaggcttccctggtggtgacgatattgggcca
cgtcctattgaccaacatattaagggctttgaagccttaggcgccagtgtaaagaatgaa
aatgatcaaattataattacagcaccagaagatggattgcatggggcaaaaattcatttg
aaaatgccatctgttggtgcaacgatgaatattattatggccagtgtaactgcgcagggt
caaactattattgaaaatgcagctaaagaaccagaaattattgatttagccaccttttta
aacaatatgggtgcagtaattcgtggtgccggaactgattcaatcagaattgaaggtgtg
gatatgcttaaagcacagattccacatacaattattcctgatcgtattgaagcaggtact
tatgtttctttggccgcttgcattggtaatggtattcgtattcataatattattgaagaa
cacctagattcttacttagctaaagtagaagaaatgggtgtagtaattaacgcagatgaa
gattcactttatgtttacccagcaggggacttaaagatggttcaggtgaagaccgatgtg
tatcctggctttgccactgaccttcaacaaccaattaccccacttcttttaactgctaaa
tcaggtgaaggcgtagtaattgataatatttatccaaaacgtaacggtcacatcccacaa
ttacaaaagatgggggctgatattaaggttgaggataatattattttggctcatccaact
aagcaacttcatggtgcagaagtaactgctggtgaaattagggcaggagcttgcttgatg
attgctggattaatggcaagtggtaccactgtaattgataaagctggcaatattttgcgc
gggtatgatcgtgtacaagagaagcttcgtcaacttggagctgatgtcacaattaaagat
gatccaagtgaacctggtatattagataatatctag

DBGET integrated database retrieval system