KEGG   Lactobacillus helveticus R0052: R0052_02330Help
Entry
R0052_02330       CDS       T02217                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lhr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lhr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
398683..400437
Genome map
AA seq 584 aa AA seqDB search
MNLFKKAVISTVAGMTLAGCLGGITSQVDAAKGHKTRVTRVTEKQINNYIKKASLKQKIG
QMYVSRTPQQPGVAEHDAYKYNLGGFIVYDADLQNYTTNQFKTKMASYQNAERIPLLIGI
DQEGGLVSRLTHSGLIPQNGDQFKFPRDQYENAEKTQKGSGMKAVTKYAHYTATLLRSLG
VNWNYAPDADYSDNPKSFIYQRGFGGVMGKQSYQGEANYISQVIPAWQHDNLIAATLKHF
PGYGDAADTHTGFAHTDKSKADIESKDMLSFKAGIKAGADSVMVTHVIYDDIDPEYPASL
SKKINTLLRKDCNFKGVIVTDALEMGAIKDFAKQHGNAPVDVLAVKAGNDMIMTTDYATG
IPEIAAAVKKGEISKTQINNSVRRILNMKNKLHLLKPSSLSLKKQNKRTFTLKDVAYNRK
DKAAVIAGTAKKGTHLSLKNTDTKKVVKKIKVGKSGNFKITLSVKEDPQNFALVGKGYVS
VNVHVQSDKVAFPVLKKFTLNAVTYNSDHRIATISGKIPDAGEEGSLIMSFLNAATNNAV
GSAVVGKDGNFSSTVRVLDKDQQIKVVAQNNKDYEAQTVTVKAK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttaaaaaagccgttatttctacggtcgcaggtatgactcttgcaggctgc
ttgggcggaattacctctcaagttgacgccgcaaaaggtcataaaactcgtgttactaga
gtgacagaaaaacaaatcaataattacattaagaaggctagtctcaagcaaaagattggt
caaatgtatgtttcaagaacaccgcaacaacccggtgttgctgaacatgatgcctataaa
tataacttaggtggtttcattgtatatgatgctgacttgcaaaattatacgaccaaccaa
tttaagactaagatggcaagctaccaaaatgcagagagaattcctcttttaatcggaatc
gaccaagaaggtggccttgtttctagattgactcacagtggtttgattccacaaaatggt
gatcaatttaagttcccacgtgatcaatatgaaaatgcggaaaagactcaaaagggcagt
ggtatgaaagctgtaaccaagtatgctcattatactgcaaccttattgcgtagcttaggc
gtcaactggaattatgctccagatgctgactatagtgacaatccaaaatcatttatttat
caacgtggttttggtggcgtaatgggcaagcaaagttatcaaggtgaagcaaattatatt
agtcaagtaattcctgcttggcaacatgataatttaattgcggcaactttgaagcacttc
ccaggctacggcgatgctgctgatactcacaccggttttgcacacactgataaatcaaaa
gctgatattgaaagcaaagatatgttgtcattcaaagctggtattaaggctggtgctgat
tcagtcatggttactcacgtaatttatgacgatattgacccagagtatcctgcttcactt
tctaaaaagataaacaccttgttgagaaaagattgtaatttcaagggcgtgattgttact
gatgcccttgaaatgggtgcgattaaagattttgctaagcaacatggcaatgctccagtt
gatgttttagcagttaaggccggtaatgacatgatcatgacgactgactatgctactggt
attccagaaattgcagctgccgttaagaagggtgaaatttctaagactcaaatcaataat
tccgtaagaagaattttgaacatgaagaataaacttcacttgttgaagccttcatcatta
agtcttaagaagcaaaacaagagaacctttactcttaaagatgttgcttacaacagaaaa
gataaagctgctgtaatagctggcacagctaagaaggggactcaccttagccttaagaat
actgatactaagaaagttgtaaagaagattaaggttggtaagagtggcaacttcaagatt
actttgtcagttaaggaagatccacaaaactttgctttagttggcaaaggatatgtcagt
gtaaatgttcacgttcaatcagataaggttgcattcccagttttgaagaaatttactttg
aacgcagtaacttacaattccgaccatagaattgcaactatctctggtaagattcctgat
gctggtgaagaaggatcattgataatgtcattccttaacgccgcaactaataatgctgtt
ggttcagctgttgtaggtaaggatggtaacttctcatcaactgtaagagttcttgataaa
gatcagcaaatcaaggttgttgctcagaataataaagattatgaagctcaaacagtaact
gttaaagcaaaatag

DBGET integrated database retrieval system