KEGG   Lactobacillus helveticus R0052: R0052_03880Help
Entry
R0052_03880       CDS       T02217                                 

Definition
galactose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R0052_03880
   00052 Galactose metabolism
    R0052_03880
Enzymes [BR:lhr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     R0052_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670803..671798
Genome map
AA seq 331 aa AA seqDB search
MKTSFNKYGREDGKDLCEIVLENDHGMIVKVLNYGATLEKVLLNDENMILSLNSPADYSQ
ERNYLGGTVGRIAGRVRKGQWRHGLETHQLPINEGENHIHGGIGTDTEVWDFKPSCSENS
ARVDLTLLDPDGHNDYPGNLKIHVKYELDNDNTLHYSINAVSDQLTIFNPVNHVYFTLGE
KDNIKDLLLQMNADYYLPVDHSGMPDRGMEKVAGTAFDFRKTKRVGDALEADDPQIKDRD
GMDHPFILNGNQPGAVLSSEDHKVTVNTDAPSLIIYTGNGFDHTGKYTADFGQYAGITFE
AQIPPAEDSDLGRITLLPNEEFERNVSWKFE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagttttaataaatatggcagagaagatggtaaggacctttgcgagatcgtt
ttggaaaatgatcatggcatgattgttaaggtgcttaattatggtgcaacgctagaaaaa
gttttgcttaatgacgagaatatgattttgtcattgaattcaccagctgattattctcaa
gaaagaaattatttaggtggtacagttggccgtattgctggtagagttagaaaaggtcaa
tggagacatggacttgaaactcatcaattaccaatcaatgagggtgagaatcatattcac
ggcggaattggtacagatactgaagtctgggattttaagccttcttgtagtgaaaatagt
gcacgagtagatttaactttattggatccagatggtcataatgattatccaggcaattta
aagattcatgtcaaatatgaattggataatgataatactttgcattactcaatcaatgct
gtgagtgaccaattaactatttttaatccggtaaatcatgtttactttaccttgggtgaa
aaagataatattaaggatttgttgttgcaaatgaatgccgattattatttaccggttgat
cattctggaatgcctgatcgcgggatggagaaagttgctggcactgcttttgactttaga
aagactaaacgtgttggggatgctttagaagctgacgatcctcaaatcaaagatagagac
gggatggatcatccatttattttgaatggtaatcaacctggtgcagttttaagttctgaa
gatcataaggtgactgtaaatactgatgccccatcattgattatttatactggaaatgga
tttgatcatactggaaagtacactgctgactttggtcaatatgctggcattacttttgaa
gcacaaattccaccagctgaagatagcgatttaggtcgcattacattattgccgaatgaa
gaatttgagcgaaatgtaagctggaagtttgaataa

DBGET integrated database retrieval system